Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002919001
Length(AA) : 386
Localization : scaffold_149
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE58174.1| Score: 388 E_value: 2e-35
KEGG Definition: predicted protein
Accession: aor:AO090003001076 Score: 388 E_value: 7e-36
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.951YES0.997YES0.822YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0130.9830.041S130

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=44.8405First60=38.0035PredHel=2
Topology=(5-27,48-70)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002919001
MRFTLFHFFYSTSFTVLFLLLAILVLITPADTIVQALIRNERINNVFIVA
GCYVLTALIALIIYVSRIYSVRRLMADIPKFYAPVRKVYLRARVHKAITA
NLSRSAVIAVQSRPREGGQGVWGEIKHPGWSDGTGRLPNVQYLSVVKELP
NLLEIEALSLRPPESSRDGLRTPTSNVFEEITMPDQEVVRRQPHMSFRAY
LNRLAAVGYVRQDVADLFMARYERARFRSQGEGIEEREFMELMHIFAGLL
KTLGDDLFTDSPSTSSRHRNWEPRDEDSNEEDHRECMGLERRDRYNSSGY
ETTSTEREEGEGLRSTPDRLNDGFVVGVQRRRPETIGSTNISMRRTTTAT
TVGSITSPEDNEIEMVSLRPRGTRRLSARTSAGTFG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1523 unnamed protein product [Aspergillus oryzae]1e-30


Manual Annotation:

Please find below the necessary files for GSTUMT00002919001 annotation :

link to GSTUMT00002919001 Artemis file
link to scaffold_149 sequence file
link to scaffold_149ESTs