Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002917001
Length(AA) : 560
Localization : scaffold_149
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: AAA family ATPase Rix7 (predicted)
Specie: [Schizosaccharomyces pombe 972h-]
Accession: ref|NP_595792.1| Score: 1725 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ani:AN1366.2 Score: 1592 E_value: 1e-175
KOG Definition: Nuclear AAA ATPase (VCP subfamily)
Classification: [Posttranslational modification
Kog Number: KOG0733 Score: 1857 E_value: 0.0
PFAM Definition: AAA, ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes..
Pfam Number: pfam00004 Score: 554 E_value: 3e-57
Swissprot: Q9DBY8|NVL_MOUSE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.084NO0.104NO0.052NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1610.0590.844_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.44702First60=0.00003PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002917001
MASPAPQKRKERRPVEDGELVKRQKQNNSREPPKDISLQDIGGREEVVDD
LLKFMTMPLTHPEVYLHTGVDLPHGVLLHGPPGCGKTMLANAIAREVGLP
FIAFSAPSIVSGISGESEMKLRKLFEEAREIAPCLMFMGEIDAITQKRDN
TQRDMERRIVAQVLTCMDDLALEKTGGKPVMIIGATNRPDSLDPALRRAG
RFDKEIYLGVPDEVGREKILRILCEKLRLIGDFDFKKLAKKTAGFVGADL
SALAREAGMVAMRRIYEILGNPSAATDPLEQLDPLYITFPDFLTALTKTQ
SLAKREGLATVPDVTWADVGALESHKAELQMAIVLPIKKPELFASVGLTA
PSGVLLWGPPGCGKTLLAKAIANESGANFINIRGPEFINKHFGELEWAVR
HVFSLARASIPCVIFFDELGALAPRHDDSSSEPSSRPVDTLLTELDGLND
CKGIYIVAATNKPDFIDPVILKPGRLDKLWFVDLPNAEGRLEILKILTKK
IPLFNVDLRAIAESDRCENFSGADLAVLVREAASLAIQKASLVDIVEVEE
AGVSATSVPI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3768 AAA family ATPase Rix7 (predicted) [Schizosaccharomyces pombe 972h-]2e-73
SY0AAC57YD11FM1 AAA family ATPase Rix7 (predicted) [Schizosaccharomyces pombe 972h-]2e-23


Manual Annotation:

Please find below the necessary files for GSTUMT00002917001 annotation :

link to GSTUMT00002917001 Artemis file
link to scaffold_149 sequence file
link to scaffold_149ESTs