Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002904001
Length(AA) : 852
Localization : scaffold_153
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An08g04480
Specie: [Aspergillus niger]
Accession: ref|XP_001392566.1| Score: 2223 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An08g04480 Score: 2223 E_value: 0.0
KOG Definition: GTP-binding protein
Classification: [General function prediction only].
Kog Number: KOG2203 Score: 1490 E_value: 1e-165
PFAM Definition: RHD3, Root hair defective 3 GTP-binding protein (RHD3). This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins. It has been speculated that the RHD3 protein is a member of a novel class of GTP-binding proteins that is widespread in eukaryotes and required for regulated cell enlargement. The family also contains the homologous yeast synthetic enhancement of YOP1 (SEY1) protein which is involved in membrane trafficking..
Pfam Number: pfam05879 Score: 2089 E_value: 0.0
Swissprot: Q8TGG5|SEY1_ASPFU

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.046NO0.137NO0.048NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2460.1060.756_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=37.7663First60=0.09167PredHel=1
Topology=(740-762)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002904001
MSVDAGGGHNRSGSMGRNGTRARDDSNSYSSGIQVIDENKEFTPYLPAYL
TAQNLITAGFSYHVVAVFGSQSTGKSTLLNHLFGTRFSVMDEQARRQTTK
GIWMSRAIEDTKKSDPREMGNNILVMDVEGTDGRERGEDQDFERKSALFA
LATSEVLIVNIWEHQVGLYQGANMGLLKTVFEVNLGLFLKDRSTTHRSLL
FFVIRDHVGHTPLQNLSNTLMQDLYRIWSSLSKPPGLEDSKISDFFDFEF
VALPHKILQPERFVEETQKLRKRFREGISPQVEAMSGSNGVERRGDGGGV
FLPAYHRRIPADGFPHYASGVWTQIVINKDLDLPSQQELLAQYRCDEIAA
TCTAGFNEIMSPFEEQAKTGRVLEGLGSAMKEALGEAMGGFEESGGRYHK
GVFERKREDLRENLEGRLRGLVVGQFSALSKRAVQEFTEEITGILKLANA
SGQSTSSNYDFAAVVNQTRSKVVDRFITEASESYIPGAEWSNYENELASL
QAALDEIAARLRGEEMKRLVARLEKAIRSKLAEPVELEFRKMEDSSKEKG
NLWDRVWKVWTEAVGEGVEGFLARAGGLNATEKERDIGAWKLRKKAWGVL
KAKIEEEVMEGNILLKLRENFEDRFRYDEQGVPRVWKPTDPIEQAYTTAR
EATLGLIPLISRIRLASGVEPPLTEFLSDPPSNFEEDVDDMGVAKDEFVV
LGEAKQVDLSTRFKRMADAVFVEAKRSTVSSVAQIPIYFWGLMLALGWNE
IWAVLRSPVYFIFLLMCCAAAYVVHTLNLWGPILRVTNAMSQQAVDIGKE
RLRDLVADPNVVYPAGLNGTRGVDDGSGAISLQTLDGEGRKRARIKREDD
DE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1541 hypothetical protein SS1G_07860 [Sclerotinia sclerotiorum 1980]8e-51
SY0AAA21YP13FM1 unnamed protein product [Aspergillus oryzae]4e-29


Manual Annotation:

Please find below the necessary files for GSTUMT00002904001 annotation :

link to GSTUMT00002904001 Artemis file
link to scaffold_153 sequence file
link to scaffold_153ESTs