Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002894001
Length(AA) : 1106
Localization : scaffold_153
Number of EST contigs matching the gene: 3
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_05607
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001246166.1| Score: 1242 E_value: 1e-134
KEGG Definition: hypothetical protein
Accession: ncr:NCU09159.1 Score: 998 E_value: 1e-106
KOG Definition: RNA helicase
Classification: [RNA processing and modification].
Kog Number: KOG1804 Score: 405 E_value: 1e-39
PFAM Definition: Atrophin-1, Atrophin-1 family. Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity..
Pfam Number: pfam03154 Score: 146 E_value: 1e-09
Swissprot: Q9HCE1|MOV10_HUMAN
Gene Ontology:
GO:0005515 = Molecular function: protein binding

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.213NO0.654NO0.187NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3610.0590.488_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01919First60=0.00027PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002894001
MSPPTPLRIVPPSPLASQAAGYVPNTSHTPLSSTSQALPTTAMSYAMVAK
CNNAPTFPSGVFQPPLSRTPQQASLPHNAQQHRQQQGIAMHPPQPFRPNP
LQPPFSPSSQLTPGASSSSPKPWQPDVYTLPFIPHYLQAINTLPAVLVAS
LPAPSIPYHSFISSFCGSTFLRPLPPAPAVPPVPSASVPVPSSDLTPTIY
SKYFFNLLSHELSAQHTEFRKYDLFNVPIYVQEPSQSLYRLDVPGIREDN
PPVLLGDVVKLRQVRQPGYMGMGGTFTGYQYDACVYGMDKTVGYIVLRVD
HLVLESGRFNVCFVVQEKQWTGATRAIEDLGAELRGTGSREVAEGAKGNG
VEANNRPGVFVRRMLFPGKEDGIWQTTLSRGVFKRRWFDRELNYEQQKAV
DTILQQNYGNVPYLISGPPGTGKTKTIVEVALQLIFTPSNPKHHILLCAP
SQEAADTLALRLVPYLNPRVLFRLQSSTRTFPEVPSELLPYSHIANDMFS
LPEWKKLMGFRVVVCSTRDAEILVEARCTNKDLARWEKSVFDSLRGIGDE
SDGNDPTASGVVEKGQIVNVHWTALLLDEAAQGIEPEVAVAVSVVVPPEE
ASVDRPIFVMAGDQRQLGPRTVSRVPQLDMSLFERLFLRELYSQHPLARQ
SFTHAYKQSPRVWSAERILERKKALLPYLRPPFTNLIRNYRSHPAILAVP
SALFYNDTLVPEASNTNYLEGWSGWKGRRGIPVKFCLNGGMDEWHEEGVS
FYNLREIKIACNIAKNLVSSGLIAPHEISIMAQFREQIRRLRRALRSPDY
NLRDVNVGPIESYQGSEHRFVIVCTTRSRERFLEGDLERGLGVIFENRRV
CVAMTRAKQGLIVIGNPWILGRDPIWRAWMGFCWRHNSVEKDFFEEEEED
KAFDPQANEKDVMLGDEDSQPNRENPPLPNGHSNHTSGKLPAITELKVNN
WQPPEDERETPQYISRLETALVYRSRVNNGYTGALGAVHGGFDEDDPMWT
AGIVAEEAVRGGIGNRDLLEPTAGTGMPWPHLLDNTHSVDGSLQGLTRRD
SSEEEGVDGEGAGADADKQAEPAARIGKNKKGFSEVKATETTQTSLFLAG
PGKLWG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig6361 No hit found
SY0AAA11YJ08FM1 No hit found
SY0AAA63YI12FM1 hypothetical protein SNOG_06451 [Phaeosphaeria nodorum SN15]2e-34


Manual Annotation:

Please find below the necessary files for GSTUMT00002894001 annotation :

link to GSTUMT00002894001 Artemis file
link to scaffold_153 sequence file
link to scaffold_153ESTs