Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002874001
Length(AA) : 336
Localization : scaffold_153
Number of EST contigs matching the gene: 2
Number of ESTs : 55
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein MGG_07016
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_370519.1| Score: 528 E_value: 7e-52
KEGG Definition: hypothetical protein
Accession: mgr:MGG_07016 Score: 528 E_value: 4e-52
KOG Definition: Predicted lipase
Classification: [Lipid transport and metabolism].
Kog Number: KOG4569 Score: 316 E_value: 6e-30
PFAM Definition: Lipase_3, Lipase (class 3)..
Pfam Number: pfam01764 Score: 328 E_value: 3e-31
Swissprot: O59952|LIP_THELA

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.933YES0.984YES0.876YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0210.9570.063S119

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=4.02772First60=3.78522PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002874001
MLPSAILTLLAVFAAGVVGSPTGIPQDDVDRDRTIEELLAMDADLVENDI
ETFSPKASARTISESELATVYYYAEFAAAAYCDPDHVPGTEASCKNNICP
QVTANSVTTIIEFADTTSSDTTGIVARDDTRRTITVSYRGTQSLGNWFAN
VQIRWSDASVYCSSCKLHTGFYNAFRDAFPPILASINSLRAQYPSYKLVV
TGHSFGGALATITATEFRRLGYTTELYTYGAPRVGNDKFCLFVSQSSGNY
RVTHLNDPVPRLPPVALGYYHISTEYWISRGDTNIKAGDVEIYEGILNTG
GNTGQSFIPPNITAHPGYFLPVGISGCGSSWDFDFF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4082 hypothetical protein NCU03639 [Neurospora crassa OR74A]2e-51
SY0AAC44YG16FM1 hypothetical protein NCU03639 [Neurospora crassa OR74A]5e-14


Manual Annotation:

Please find below the necessary files for GSTUMT00002874001 annotation :

link to GSTUMT00002874001 Artemis file
link to scaffold_153 sequence file
link to scaffold_153ESTs