Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002844001
Length(AA) : 792
Localization : scaffold_148
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: mitochondrial exoribonuclease Cyt-4
Specie: [Aspergillus fumigatus Af293]
Accession: ref|XP_746777.1| Score: 657 E_value: 2e-66
KEGG Definition: mitochondrial exoribonuclease Cyt-4, putative [EC:3.1.-.-]; K01175
Accession: afm:AFUA_7G01550 Score: 657 E_value: 1e-66
KOG Definition: Exosomal 3'-5' exoribonuclease complex
Classification: [
Kog Number: KOG2102 Score: 339 E_value: 4e-32
PFAM Definition: RNB, RNB domain. This domain is the catalytic domain of ribonuclease II..
Pfam Number: pfam00773 Score: 490 E_value: 1e-49
Swissprot: P47950|CYT4_NEUCR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.029NO0.077NO0.040NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1630.0280.89_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.09466First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002844001
MSEIHGSKVDPSDIAAPRTRTEGILDPVRQFGGVAARLYAEHRPAFDGLY
AKWADETEERKITLFEATEMAFGIGCNQDPNYNAMLYAVHTALMGDGLHF
MGDRGMHRATNIFRVRSKKDIRMIDSVTELIRKTADKQQSTDKSGRMTAE
DTGRKVMAKFIEKANYLIDLSREYEKEVLVGRKNGAPLVETVEIEELKWE
ENDKFFIEYVKARVLKYGLQKTPIDGLAPVILRATNKYGDVLDALTADKF
LREIGAWSKWENTSLHQSGLDLPGLGRSELGDQEEDRLRLLNQEGAIEKL
GLTDVMHNVRKDWGDMQVFTIDDPDAYEIDDGVSLERVSDTENWVHVHIA
NPTAFIPEDHWIAEIAKRRATAHYLPDKFYSMLPEGITGTFLGVAPNKPV
MSISTKVNDKGEILDHKIQAGFVRNVRRTTYDAVDHALGSYQTVNFIADL
RIGKFPSRLRATSKADKFTPKQLSDLQKLRDIALTVRRRRARDGLITLAS
ANLQVEVYNGLGSRNHPYNSSYPVLYRGHPAVHLTVADSAAVELRDSQLM
VSEMMSLANNVASIWSRERRLAMPYRVMEYDYGRPDVVKTIEETVLPRRT
DLGCPPFDSTIRWLMLLGQTRLQASPGPHMLMGLPTGYAKATSPLRRYAD
MLAQYQIQSVLLNRSPKTAAQLEPIIASVQRTEQTAKHISKEANRLWSAV
AIKRAWETGLEKYTFPEKLTFLVMEKHSSPTPCNGIVRELGLAAKMCFAD
RRDEAKVQVGNVVSVKIHNVSLSERYVWFEFTGVVGASVLGV

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB59YK08FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00002844001 annotation :

link to GSTUMT00002844001 Artemis file
link to scaffold_148 sequence file
link to scaffold_148ESTs