Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002833001
Length(AA) : 273
Localization : scaffold_148
Number of EST contigs matching the gene: 5
Number of ESTs : 67
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE62127.1| Score: 489 E_value: 2e-47
KEGG Definition: reductases with broad range of substrate specificities
Accession: aor:AO090701000415 Score: 489 E_value: 8e-48
KOG Definition: Reductases with broad range of substrate specificities
Classification: [General function prediction only].
Kog Number: KOG0725 Score: 425 E_value: 1e-42
PFAM Definition: adh_short, short chain dehydrogenase. This family contains a wide variety of dehydrogenases..
Pfam Number: pfam00106 Score: 224 E_value: 3e-19
Swissprot: Q9Y6Z9|SOU1_SCHPO
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.140NO0.398NO0.120NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0620.2120.785_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.38896First60=0.13291PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002833001
MSLTAPSESTPLAQLFSLEGKVCLVTGGNRGIGLAVCQGYAEAGAAGIAI
IHSSEATARLASERATEIQQKHPKTIVRTYRANVAVSKDIEEATKQAFSD
FGRLDVVVANAGVYTETPTLEMSSEEAEYVTGVNYFGPLYTAQAAARVFK
ENGGGKIIMTASINGHMVLRPQYESIYCATKAAVCHLTRALAVEFAQWNI
QVNAISPGYIDTEMTTELVNEKPELIKAWMVDCPAGRLCKVWELKGVYVF
LASGASSYVTGADYVVDGGHTCH

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1691 unnamed protein product [Aspergillus oryzae]5e-22
Contig1946 unnamed protein product [Aspergillus oryzae]4e-48
Contig2323 unnamed protein product [Aspergillus oryzae]1e-28
Contig2477 unnamed protein product [Aspergillus oryzae]2e-28
Contig3120 short chain dehydrogenase [Mycobacterium tuberculosis H37Ra]1e-19


Manual Annotation:

Please find below the necessary files for GSTUMT00002833001 annotation :

link to GSTUMT00002833001 Artemis file
link to scaffold_148 sequence file
link to scaffold_148ESTs