Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002795001
Length(AA) : 509
Localization : scaffold_147
Number of EST contigs matching the gene: 2
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_04620
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001594812.1| Score: 737 E_value: 8e-76
KEGG Definition: integral peroxisomal membrane protein
Accession: afm:AFUA_7G04160 Score: 720 E_value: 3e-74
KOG Definition: No Hit Found
PFAM Definition: Pex24p, Integral peroxisomal membrane peroxin. Peroxisomes play diverse roles in the cell, compartmentalising many activities related to lipid metabolism and functioning in the decomposition of toxic hydrogen peroxide. Sequence similarity was identified between two hypothetical proteins and the peroxin integral membrane protein Pex24p..
Pfam Number: pfam06398 Score: 413 E_value: 6e-41
Swissprot: Q06169|PEX30_YEAST
Gene Ontology:
GO:0005779 = Cellular component: integral to peroxisomal membrane
GO:0042802 = Molecular function: identical protein binding
GO:0007031 = Biological process: peroxisome organization and biogenesis

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.021NO0.057NO0.018NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.130.1010.846_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=52.2877First60=0.00901PredHel=2
Topology=(107-126,183-205)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002795001
MSDEPSSGAEPLTDLHPTPSTRDPNPPTFASFAPPSSSPAARSTFQVHQK
SPLLAATPPRVTRALSRAFPYLSGLNWVAGLLTWTTKDPWESFLVVAAFW
AAVLYGDVGLRWGGNVVVVALLILGMFLRRYRDEPTPTTLDEILETLSTL
TTRLNIFFEPFLSLTRFLSTTVTATTATTRPVLTTLFFRILITTPIWLFF
TIYPFQVITTRRVVLATGTLILSWHSRPAKVSRTILWRSSLIRAVCSYVT
GLTLRAPSLQIDPSKSTPLTASTTGASPGVKFTFAIYENQRRWLGVGWTS
SLFAYERAPFTDEHLQPCPQPEEFALPETPAGSGVRWRWVEGEEWRVEGA
DGHGKKSKGQEVKDKLGGSGEVGEGWVYYDNKWRDGRRGVDGWGKYTRRR
KWYRNAELVEDLGSDDSDGEGEAEVDAQEKEEITETAFSPLTNEENQKEE
QLYRRTENEEDEGDVSMDEVPDVIVTSEEDGTGEEKQKYIMEKNVVSGNG
AARPPLPPR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig671 No hit found
Contig1769 hypothetical protein SS1G_04620 [Sclerotinia sclerotiorum 1980]5e-70


Manual Annotation:

Please find below the necessary files for GSTUMT00002795001 annotation :

link to GSTUMT00002795001 Artemis file
link to scaffold_147 sequence file
link to scaffold_147ESTs