Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002772001
Length(AA) : 855
Localization : scaffold_145
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein
Specie: [Yarrowia lipolytica]
Accession: ref|XP_500953.1| Score: 538 E_value: 2e-52
KEGG Definition: hypothetical protein
Accession: yli:YALI0B15972g Score: 538 E_value: 8e-53
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: P80109|PHLD_BOVIN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.964YES0.992YES0.818YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0710.9230.038S116

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.49185First60=2.48005PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002772001
MMRVLAGLSLLGLASACGVLVHNEVFQRSADVFALPTSNEDISTHQGVFS
RLLKIHTESVQAGAFFPDWGYQCLNTNDDAEAAHWPPFLIASVEHINSRY
GSLTSKQRTPEEQEHLEKLIGFVFAVASHQVADATWHAIRLPTAFLSALA
GVDFDGDEAAAHRVLDFGGDVVLSSRIARNGEDGKVWIGDRWWVPVEDLV
AIYSRIGRDVSSFVMRYCTMRGLAALKSRYDTVASDSPMLTAELDGYYLG
GINEMAARSVTCWANLTKWIAFGIDKEEKLMNGWGVCDVFRAIQARGGAG
SSLHGEYRERKMTGKRMRKYPGGITFTKDRFGAESYHIPGMHPPSVEKPM
SLKLSQDAPKLRDPIYTSAYQFYSHFGASLSIGEFSPFDDGQAIAIGAPW
ESTDSSKPGEGNVYILPLKDFAKPTLQSVPKPLPLVKQPTASTDQRFGIS
TTPWRIMNTTFLAVAAAGPLTYDPSTPPSLPFQGTSPAGKIHVFPKGSGS
SVFSITFKGAELGSIGRRWWGETMLSADLAGDGEEKLIVSGSRSDGLRIC
EGRGKVQFGEGEIAVISPSRSSSSPSSSDQPIHVELSEGQDILLNATILS
LPESAKATPCSKTSTYENFGAAIAFSAHSRTLFISAPGTSSVFAYRWNPI
SSSLKHVYTIPAPRAPRPFLPSSSSSRGNFGATVTAGYTSGIEWLAISAT
NEDVDGVKQSGVLRLYTLSQTGAELVAEVAPEPTGAEWARFGKALAKDGD
SGLWIGSEFWDAGRGAVWWLHVGRVLDGERVVARAQVVLKEQEEAVKKIS
LKPVRVGQEANARFATSIASGANRELIVGIPRAGVTHPLQSERFFGYVAF
FGRVG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4116 hypothetical protein [Yarrowia lipolytica]6e-13
SY0AAB31YO08FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00002772001 annotation :

link to GSTUMT00002772001 Artemis file
link to scaffold_145 sequence file
link to scaffold_145ESTs