Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002762001
Length(AA) : 990
Localization : scaffold_145
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: Ankyrin repeat protein
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP48589.1| Score: 1165 E_value: 1e-125
KEGG Definition: ankyrin
Accession: aor:AO090138000202 Score: 1094 E_value: 1e-117
KOG Definition: Ankyrin
Classification: [Cell wall/membrane/envelope biogenesis].
Kog Number: KOG4177 Score: 501 E_value: 7e-51
PFAM Definition: No Hit Found
Swissprot: P16157|ANK1_HUMAN
Gene Ontology:
GO:0016323 = Cellular component: basolateral plasma membrane
GO:0005856 = Cellular component: cytoskeleton
GO:0008093 = Molecular function: cytoskeletal adaptor activity
GO:0019899 = Molecular function: enzyme binding
GO:0030507 = Molecular function: spectrin binding
GO:0005200 = Molecular function: structural constituent of cytoskeleton
GO:0007010 = Biological process: cytoskeleton organization and biogenesis
GO:0006887 = Biological process: exocytosis
GO:0045199 = Biological process: maintenance of epithelial cell polarity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.033NO0.068NO0.035NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0890.060.919_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.08285First60=0.0004PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002762001
MAQNINIHSISVGDGNAHCGNLNITGNFNQTIHKSDEDVQILRWLSPLEP
SNRHQGVRSERFDGVGDWLLETREFREWRGGKGGADGAILFCSGNPGVGK
TYLSSLVIDRLCDQAQEEDITVAGFYCDFVVQQEQTIAHMMGIILKQLAG
KEGIPNYLREAFYKAKREFGGRGLQLPEVMKMLKIAMASLPQVFICIDAL
DECLPKDLPKLLQSLRDIVRASPKTRIFLTGRPHVREDVQRYFGKAVVIP
ISPTTDDIRRYIEKRLDEDADPEAMNDDLRADIIRTILDKISDIFLLVSL
NINAILEEVTIRQRRKKLEEMTKGDGLRDAYTATLTRLKAQKGNKAILGM
KVLMWVLYSERPLRAKELPDALGVEMGSTDLDAENVPALRTLLASCLGLV
TVEASSSAVRLVHYTLQEHLSDDATLFPSPHSKIAEVCLTYLNFECVRTL
PPTLRRAPATVPLLEYASYYWWKHTRRGMTENVKALALRLLERFDEHISA
QLILYYQCRWGRRPYFRPREGPTGFTGLHAVASLGVVGIVATILEMREWD
VCATDCTGNTALIWAAVRGNEEVVKVLLDREDVNPNQTDIKHGRTPLTWA
ARSGHEAVVKLLLKRVDVDLSQADTEYGRTPLSWAAENGHEGVVKMLLER
ADVNPNQVDIRYGQAPLSWAAKKGHGGVVRLLLERVDVNTDQADSKYGQT
PLSLAAENGHEAVVKMLLERVDVNPNQADTFCGQTPLSWAAENGHEGVVK
LLLERGSVNPDQADTKYGQTPLLMAAMNGHERVVEMLLERVDVNPDRADK
CGQTPLLWAAENGHEAVVKMLLERVDVNPDRADKYGQTPLPWAANYCHEA
VVKMLLERVDVNPDQTDTEYGQTPLSMAAENGHEGVVKMLLGRVDVNPNK
ADTFCGQTPLSWAAENGHEAVVKMLLERVDVNPNQADTEYGRTPLTQAAE
NGHEGVVKMLLERVDANPNQADNICGQTPLSVAAENGHEG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3428 Ankyrin repeat protein [Aspergillus fumigatus A1163]7e-17
SY0AAB51YN24FM1 Ankyrin repeat protein [Aspergillus fumigatus A1163]4e-38


Manual Annotation:

Please find below the necessary files for GSTUMT00002762001 annotation :

link to GSTUMT00002762001 Artemis file
link to scaffold_145 sequence file
link to scaffold_145ESTs