Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002721001
Length(AA) : 336
Localization : scaffold_146
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: 3' exoribonuclease family protein
Specie: [Aspergillus fumigatus Af293]
Accession: ref|XP_755933.1| Score: 421 E_value: 2e-39
KEGG Definition: 3' exoribonuclease family protein
Accession: afm:AFUA_2G15980 Score: 421 E_value: 9e-40
KOG Definition: Exosomal 3'-5' exoribonuclease complex
Classification: [
Kog Number: KOG1068 Score: 269 E_value: 2e-24
PFAM Definition: RNase_PH, 3' exoribonuclease family, domain 1. This family includes 3'-5' exoribonucleases. Ribonuclease PH contains a single copy of this domain, and removes nucleotide residues following the -CCA terminus of tRNA. Polyribonucleotide nucleotidyltransferase (PNPase) contains two tandem copies of the domain. PNPase is involved in mRNA degradation in a 3'-5' direction. The exosome is a 3'-5' exoribonuclease complex that is required for 3' processing of the 5.8S rRNA. Three of its five protein components contain a copy of this domain. A hypothetical protein from S. pombe appears to belong to an uncharacterised subfamily. This subfamily is found in both eukaryotes and archaebacteria..
Pfam Number: pfam01138 Score: 159 E_value: 1e-11
Swissprot: Q9P7R3|YHV8_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.142NO0.276NO0.089NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5350.0440.567_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.07412First60=0.05264PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002721001
MTDRRRINGPLEGTIPPVFLTSSTHKSIIKRSPTTLRKIFLKTGLTPPAT
GSAFLELPTPSTHSTPTLKLTSSVYGPRPLPSSTTFSSNARLTAELKFSP
FSTPGRRRGYIRDGVERDLSAQLSIALGKSVAVGKYPKSAIDVFVSVLDC
EGGLGDAGDEAGGGVDVGLMSVLATAISCASAAIADAGIECFDLVAGGVA
GLVLEQGGVVEEDRVEKSLEVGQDSDDARRGMRKNGKVTLVLDPSPIDGY
IILAAAAVGYMAARDELTLVWTKGSMGWDGDSTDEVERIVDGAITASTGV
RLVINEAVKERLLLGLKEMGLIRGKAVSGDGDAAMS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4563 hypothetical protein MGG_07084 [Magnaporthe grisea 70-15]2e-27
SY0AAD51YL24FM1 hypothetical protein FG04277.1 [Gibberella zeae PH-1]5e-10


Manual Annotation:

Please find below the necessary files for GSTUMT00002721001 annotation :

link to GSTUMT00002721001 Artemis file
link to scaffold_146 sequence file
link to scaffold_146ESTs