Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002589001
Length(AA) : 521
Localization : scaffold_137
Number of EST contigs matching the gene: 3
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CHGG_09750
Specie: [Chaetomium globosum CBS 148.51]
Accession: ref|XP_001227677.1| Score: 1665 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ncr:NCU06918.1 Score: 1585 E_value: 1e-174
KOG Definition: Xanthine/uracil transporters
Classification: [Nucleotide transport and metabolism].
Kog Number: KOG1292 Score: 336 E_value: 5e-32
PFAM Definition: Xan_ur_permease, Permease family. This family includes permeases for diverse substrates such as xanthine, uracil and vitamin C. However many members of this family are functionally uncharacterised and may transport other substrates. Members of this family have ten predicted transmembrane helices..
Pfam Number: pfam00860 Score: 557 E_value: 1e-57
Swissprot: P48777|UAPC_EMENI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.032NO0.072NO0.029NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0920.2320.834_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=224.972First60=0.01772PredHel=10
Topology=(79-101,108-130,135-154,175-197,262-281,294-311,331-353,407-429,439-461,474-496)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002589001
MTEPDQIVPSTVRKRTFGDHARSVKKALLTKEGLLGDYDYAFLFRPRLPF
MRKPRRSAPFFGLDDRMPVLLALLLGFQHALAMLAGVVSPPLILGGAGGA
NLSAGAQQYLVSTALIVCGILSAIQITRFHIWGTPYYIGTGLISVVGTSF
AIIPVAQGALEQMYANGKCSHDRTQQGLPKVYPGAILGTGCVCALLEIAL
SFMPPRLLQKIFPPLVTGPTVMLVGVKLIASGFKNWAGGNGPCADSPKTG
PFSLCPNTAAPHPLPWGSAEFIGLGFSVFIAIIICERFGSPVMQSTSVAI
GLLFGCIIAAATGYFSKKNIDLAPTVSFIWVQTFKLSIYGPLVLPTLAVY
IILACEAIGDISATCDVSKLDVDGKMFDSRIQGGLLADGINGLLASLATI
TPMSTYAQNNGVIALTRCANRGAGYGCCFFLIIMGIFSKFAASLVAIPSA
VLGGMTTFLFCSVAVSGMRITATMPFTRRSKLFFFSPPLFLSHALCSIRQ
LGLLRHRSFNRLVSRNNSKFF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1608 hypothetical protein CHGG_09750 [Chaetomium globosum CBS 148.51]2e-30
Contig4907 hypothetical protein CHGG_09750 [Chaetomium globosum CBS 148.51]6e-92
SY0AAA50YL13FM1 hypothetical protein CHGG_09750 [Chaetomium globosum CBS 148.51]3e-36


Manual Annotation:

Please find below the necessary files for GSTUMT00002589001 annotation :

link to GSTUMT00002589001 Artemis file
link to scaffold_137 sequence file
link to scaffold_137ESTs