Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002563001
Length(AA) : 280
Localization : scaffold_133
Number of EST contigs matching the gene: 3
Number of ESTs : 8
  User annotation : TmelFCR3  [+]

Blast Results:

Nr Definition: hypothetical protein BC1G_01237
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001560405.1| Score: 519 E_value: 6e-51
KEGG Definition: hypothetical protein
Accession: ncr:NCU01994.1 Score: 502 E_value: 3e-49
KOG Definition: Predicted translation initiation factor related to eIF-3a
Classification: [Translation
Kog Number: KOG2315 Score: 112 E_value: 2e-06
PFAM Definition: bZIP_1, bZIP transcription factor. The Pfam entry includes the basic region and the leucine zipper region..
Pfam Number: pfam00170 Score: 124 E_value: 9e-08
Swissprot: Q8X229|FCR3_CANAL
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0003700 = Molecular function: transcription factor activity
GO:0045893 = Biological process: positive regulation of transcription
DNA-dependent

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.068NO0.159NO0.055NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2370.0430.779_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00059First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002563001
MASYQPTFFTQPQAIYQPTPTSSHQADEFSSLSFPNYPTFDFFEQQSHHN
ITPSLRGHTPIDPETHRNGRSSSEEKELTPGQRRRKEQNRAAQRAFRERK
ERHVKELEHRLKTLEQHASETASQNEILKQELQKTKLENRLLQENSLRGN
SPPAMTEVANMNFKPTDHHNIANPPPAFTSPIFGEHPNRGPLHRISTSPK
TGERLLGAGAAWDLIVCHPLYEQGLVDIGDISDRLKGLARCDGQGPVFEE
SVILEAINASSGSGRDELLMESSPPGMSYN

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig199 hypothetical protein NCU01994 [Neurospora crassa OR74A]2e-09
Contig2771 hypothetical protein BC1G_01237 [Botryotinia fuckeliana B05.10]1e-50
SY0AAB20YM23FM1 hypothetical protein CHGG_06554 [Chaetomium globosum CBS 148.51]2e-21


Manual Annotation:

Please find below the necessary files for GSTUMT00002563001 annotation :

link to GSTUMT00002563001 Artemis file
link to scaffold_133 sequence file
link to scaffold_133ESTs