Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002511001
Length(AA) : 368
Localization : scaffold_131
Number of EST contigs matching the gene: 2
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU04776
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_960225.1| Score: 375 E_value: 5e-34
KEGG Definition: hypothetical protein
Accession: ncr:NCU04776.1 Score: 375 E_value: 2e-34
KOG Definition: RhoA GTPase effector DIA/Diaphanous
Classification: [Signal transduction mechanisms
Kog Number: KOG1924 Score: 153 E_value: 5e-11
PFAM Definition: Drf_FH1, Formin Homology Region 1. This region is found in some of the Diaphanous related formins (Drfs). It consists of low complexity repeats of around 12 residues..
Pfam Number: pfam06346 Score: 119 E_value: 6e-07
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.105NO0.153NO0.065NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5730.0450.529M547

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002511001
MDGPRRPHRSHRSHRPRDHSHSPHHYSRHHRHHDRNSRSSSQSRDHHSRE
RHSRNHHRHHRHHKRTRSPSPTIVRPLNAPRISRHDFEFHRDVFADYLDI
QKGLTLSELDRAEAKGRFKRFVTHYNHGELARGWYDRIVNRKASDSTKAP
EEQRSNSKKDEDSTWPEKKRRRMDTPRSDKKGESEEENESENGETSEEEI
VGPLLPGQQPSKRSRARGPTIPSIEDLDLQKELLREDQTLQHLNLRHARK
QERKLEKERLEELVPRAAPGTHERQLEKKAELNAKMKSFLEKSPDLEVNE
ETLMGSGGTDGFKQRKAAIERKKNDREIRKEELLRARIAEREERLQQHRD
KEERTMAMLKQLASRFNN

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1469 hypothetical protein SS1G_14406 [Sclerotinia sclerotiorum 1980]3e-16
Contig6578 hypothetical protein FG08432.1 [Gibberella zeae PH-1]3e-19


Manual Annotation:

Please find below the necessary files for GSTUMT00002511001 annotation :

link to GSTUMT00002511001 Artemis file
link to scaffold_131 sequence file
link to scaffold_131ESTs