Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002482001
Length(AA) : 485
Localization : scaffold_136
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein MGG_02465
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_365763.1| Score: 1496 E_value: 1e-164
KEGG Definition: hypothetical protein [EC:3.1.1.45]; K01061 carboxymethylenebutenolidase
Accession: mgr:MGG_02465 Score: 1496 E_value: 1e-164
KOG Definition: Sterol reductase/lamin B receptor
Classification: [Lipid transport and metabolism
Kog Number: KOG1435 Score: 1087 E_value: 1e-119
PFAM Definition: ERG4_ERG24, Ergosterol biosynthesis ERG4/ERG24 family..
Pfam Number: pfam01222 Score: 1314 E_value: 1e-145
Swissprot: P36209|STS1_SCHPO
Gene Ontology:
GO:0043157 = Biological process: response to cation stress
GO:0042493 = Biological process: response to drug

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.067NO0.096NO0.045NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1720.1970.629_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=193.55First60=8.95248PredHel=9
Topology=(52-74,112-134,155-177,187-209,230-252,262-281,302-324,334-353,418-440)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002482001
MEVRSRRKPYGENGSTSGPTIPKGDVGSDTTTKDNLRMGDDHRVDNSSEF
EFGGVWGTGLAMVFFPLLMWYMWVGQVYYNSQFPMPGKEEAIGNFVRKVA
KLAYECSYPTKKAWLVYWGFLAYQSLLYLTLPGVWAKGNPIPHRNNVRLD
YYCNAIWAFYFTTATAIVFHVAQILPITFLVDEFGSFMSVGILSGILVSF
IGYFSAIYRGAQHRMTGRFVYDFFMGAELNPRIFGLMDLKMFLEIRLPWF
ILFLVSCAAAVKQYETLGYVTPQVAFFVLAHWLYANACSKGEELVITTWD
MSYEKWGYMLIFWNMAGVPLTYCHGVLYLVKHNPSVYQWCTGVNVSLYIF
LLCAYYVFDTCNSQKNRFRQMEKGTLVIRKAFPQLPWQTLKNPKFIRCRN
GGTLLTSGWYGLARKVHYTADFCQLTSWGLICGFSSPLPWFLPAFFMAMI
LHRAWRDTDRCAKKYGADWEEYKRQVPYLFIPYVI

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB17YK11FM1 hypothetical protein MGG_02465 [Magnaporthe grisea 70-15]5e-50


Manual Annotation:

Please find below the necessary files for GSTUMT00002482001 annotation :

link to GSTUMT00002482001 Artemis file
link to scaffold_136 sequence file
link to scaffold_136ESTs