Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002456001
Length(AA) : 1134
Localization : scaffold_136
Number of EST contigs matching the gene: 3
Number of ESTs : 6
  User annotation : TmelRPH1  [+]

Blast Results:

Nr Definition: hypothetical protein An08g04970
Specie: [Aspergillus niger]
Accession: ref|XP_001392615.1| Score: 1772 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An08g04970 Score: 1772 E_value: 0.0
KOG Definition: DNA damage-responsive repressor GIS1/RPH1
Classification: [
Kog Number: KOG0958 Score: 975 E_value: 1e-106
PFAM Definition: JmjC, JmjC domain. The JmjC domain belongs to the Cupin superfamily. JmjC-domain proteins may be protein hydroxylases that catalyse a novel histone modification..
Pfam Number: pfam02373 Score: 377 E_value: 2e-36
Swissprot: P39956|RPH1_YEAST
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0051864 = Molecular function: histone demethylase activity (H3-K36 specific)
GO:0032453 = Molecular function: histone demethylase activity (H3-K4 specific)
GO:0032454 = Molecular function: histone demethylase activity (H3-K9 specific)
GO:0016566 = Molecular function: specific transcriptional repressor activity
GO:0006281 = Biological process: DNA repair
GO:0016577 = Biological process: histone demethylation
GO:0000122 = Biological process: negative regulation of transcription from RNA polymerase II promoter

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.055NO0.095NO0.045NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1270.0710.87_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.0014First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002456001
MAAAIMDPVTTSGEGSRFEVVVEKRQLNNGEQFEVFPEEKDEEITPSYYY
ENMGIPVFEPTMDQFRSFKHFVNKINHYGMQSGIVKVIPPKEWTDSLASL
EDKLKDIRIKNPIIQHMAGVAGEYRQENIEKQRTYNLPQWRQLCESSEHQ
PPAKRGERRKGQAIKEAPEREAEQAIADDEAFDGFDFRIHNADDYTPERC
DELEKAYWRTLTYSNPLYGADMPGSLFDDSITSWNVAKLENLLDCLGKKL
PGVNTAYLYLGMWRSTFAWHLEDVDLYSINYIHFGAPKQWYSISREDKPK
FEQVMRGKFFSFSSQSALSLTYDRVAGIWPNDSKKCSQFLRHKNYLVSPS
LLLGHGIKVNKLVHHQGEFVITFPFGYHSGYNLGYNCAESVNFATEAWLE
YGRNAKKCECIKDSVWVDVDEIERKLRGESTEDEGDEIEYYYGDEDEDEM
EANDLPTPPESVEGKPVKTKNHKKRKLEDGKERPAKVKKLRLKLSKEAAP
EPCILCPNNIPYEELVATDDGQKAHRLCAIYTPETYFKWDEAQQQEVVAN
IPGIPRARLELRCIFCRSTKGACFQCSSKKCARAYHATCAAAAGVLVNMF
DVPHYGEDGQMYPQTDIDFRCRFHRPKRPKGMDSEKLESDMVVRKFANSL
IKGDVIQMQYYRGDIFGGVVIENRYSEECVVVNVLPKGTESLEVEWKWIL
AQDPSTVPLPLPLTEMPMYPTAQQSGVATTKAPKLVPEPDDPFCDEASGL
KWGELIMAGPPVNADQAPVDLSNSIWHYLGEHSTEYIAKYTDDPEKRVPN
EAASMGSTRKPRAKIIKTPAKVLKPMHHSPGPLQRSQELQSPYTPDQTRD
HHSPQSHLTGGGVNISHLSQQQLWPSAYQPSVPTVSSGTSIANIVADATK
AFINEHALFQTQEHAILTQILPGRETGMSASQPLTLMNDGARQHDDDFSN
QESIQSSTTSNSMIDPQLMAQGTGLVATPPSQQIEAYDPVFVAQQTSALS
TQTTGPAHDMTETLPRGVNSPEQVSAPTVVATPQGSSITSVPQSPPPSSA
LPAVDHSPNTSLPHQPLSSTPPRKLVPLADIQAALAQLARAKAQEQKAKA
DVEAAQAEVGAARARARQSAATAFGQTPAPPSQA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1821 jumonji family transcription factor, putative [Neosartorya fischeri NRRL 181]3e-87
Contig3765 hypothetical protein NCU03505 [Neurospora crassa OR74A]3e-63
SY0AAC27YI06FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00002456001 annotation :

link to GSTUMT00002456001 Artemis file
link to scaffold_136 sequence file
link to scaffold_136ESTs