Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002451001
Length(AA) : 1496
Localization : scaffold_136
Number of EST contigs matching the gene: 3
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: glutamate synthase Glt1
Specie: [Aspergillus fumigatus Af293]
Accession: ref|XP_750485.1| Score: 6343 E_value: 0.0
KEGG Definition: glutamate synthase Glt1, putative [EC:1.4.1.13]; K00265 glutamate synthase (NADPH) large chain; K00266 glutamate synthase (NADPH) small chain
Accession: afm:AFUA_1G07380 Score: 6343 E_value: 0.0
KOG Definition: Glutamate synthase
Classification: [Amino acid transport and metabolism].
Kog Number: KOG0399 Score: 5902 E_value: 0.0
PFAM Definition: Glu_synthase, Conserved region in glutamate synthase. This family represents a region of the glutamate synthase protein. This region is expressed as a separate subunit in the glutamate synthase alpha subunit from archaebacteria, or part of a large multidomain enzyme in other organisms. The aligned region of these proteins contains a putative FMN binding site and Fe-S cluster..
Pfam Number: pfam01645 Score: 1440 E_value: 1e-159
Swissprot: Q9C102|GLT1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.040NO0.137NO0.045NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1670.0380.873_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.2924First60=0.00354PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002451001
MTHRGAVGSDARDGDGAGVMTSIPHKFFVKEFTGSSGFVLPPQGQYAVGN
LFFKPSEEVLIESKNTFIELADSLGLRVLGWREVPRDSALLGPAALSREP
TILQPFVVLRSRYGEGEKPENTDAESFDEKYFERQLFILRKVSTKKIGLH
NWFYICSLSNKNIVYKGQLAPVQVYTYYHDLVNVDYAVHFALVHSRFSTN
TFPSWDRAQPLRWVAHNGEINTLRGNKNWMRAREGQMKSAKFGEELEQLY
PIIEEGGSDSAAFDNVLELLTINGVLSLPETIMMMVPEAWQDNALMDPKK
VAFYEWAACLMEPWDGPALFTFADGRYCGATLDRNGLRPCRFYVTDDDRI
ICASEVGTILIDPEHIIQKGRLKPGRMLLVDTVEGRIVDDKELKMGVSSR
FDFTSWVEEQLLTIKKVYNQLESSGVRLEPSLDDNSLQNDPRLLAFGYSF
EQVSLILGPMAADSKEALGSMGNDAPLACLAKQPRLLYEYFRQLFAQVTN
PPIDPIREAIVMSLECYVGPQGNVLEMGPSQCHRLLLPSPVLSPNEFNAL
TSIQQVNNSWTVHTIDITFPKEQGVPGYINALDEVCMQASKAIEKGDKVL
VLSDRNTSADRVPLSALLACGGVHHHLVRNRMRSKIALVIETAEAREVHH
LCVLLGYGADAICPYLAMECILKMNREKLIRGGLSDEKVVDNFKHSCDGG
ILKVMSKMGISTLQSYKGAQIFEALGVDDSVVDRCFTGTATRIKGITLDF
IAQDAFALHETGYPSRKIVSIPGLPETGEYHWRDGGESHVNDPVSIANIQ
DAVRTKNDKSYEAYSLSEYEQIKNCTLRGLLDFDFSSSKPIPIDQVEPWT
EIVRRFCTGAMSYGSISMESHSTLAVAMNRLGGKSNTGEGGEDPERSQIL
ENGDTMRSAIKQVASGRFGVTSHYLADSDELQIKMAQGAKPGEGGELPGH
KVSQSIARTRHSTPGVGLISPPPHHDIYSIEDLKQLIYDLKCANPRSRVS
VKLVSETGVGIVASGVAKAKADHILISGHDGGTGASRWTGIKYAGLPWEL
GLAETHQTLVLNDLRGRVIVQTDGQLRTGRDVAIACLLGAEEWGFATTPL
IAMGCIMMRKCHLNTCPVGIATQDPELRKKFTGTPENVINFFYYVANELR
AIMARLGFRTINEMIGRSEKLLVRRDLMTEKTNNIDLSLILTPAHTLRPG
VATYNVRKQDHRLHVRLDNKLIDESEYTLEKGIPTRIESDIVNTDRALGA
TLSYRISRKMGEAGLEPDSVHVNLRGSAGQSFGAFLAPGVTLELEGDAND
YVGKGLSGGRVVIYPPRNATYKAEENIIVGNVCLYGATAGQCFFRGVAAE
RFAVRNSGATAVVEGVGDHGCEYMTGGRVIILGETGRNFAAGMSGGIAYV
LDIKQNFASKVNMEMVELSGVEDAHEISWVRGLVEDHYQFTGSELAKRIL
LDYRRALPRFSSGRGSTKIEGLPIPIRSTSRQPGGGRQAQACGCYD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig6569 glutamate synthase precursor [Neurospora crassa OR74A]1e-176
SY0AAA25YE03FM1 hypothetical protein An07g09920 [Aspergillus niger]1e-101
SY0AAA52YJ18FM1 glutamate synthase [Gibberella fujikuroi]6e-99


Manual Annotation:

Please find below the necessary files for GSTUMT00002451001 annotation :

link to GSTUMT00002451001 Artemis file
link to scaffold_136 sequence file
link to scaffold_136ESTs