Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002450001
Length(AA) : 510
Localization : scaffold_136
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An07g09920
Specie: [Aspergillus niger]
Accession: ref|XP_001392067.1| Score: 2161 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An07g09920 Score: 2161 E_value: 0.0
KOG Definition: Glutamate synthase
Classification: [Amino acid transport and metabolism].
Kog Number: KOG0399 Score: 2047 E_value: 0.0
PFAM Definition: Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain..
Pfam Number: pfam07992 Score: 328 E_value: 5e-31
Swissprot: Q9C102|GLT1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.022NO0.074NO0.019NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2410.0380.828_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00413First60=0.00016PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002450001
MLYSRRHEKYRNSKTRTKDWQELSRRLDEDELKYQSARCMDCGVPFCQSD
TGCPISNIIPKWNELVFQNQWKNALLKLLQTNPFPEYTGRVCPAPCEGAC
VLGINEDPVGIKNIECAIIDRGFEMGWMIPTPPEVRTGKKVAIIGSGPAG
LAAADSLNKAGHLVVVYERADRIGGLLMYGIPNMKLDKSIVQRRTDFMAA
EGIKFVTGTHVGEDIKLSSLREQNEAVIIATGATVARDLPIPNRNLDGIH
YAMTFLHANTKSLLDSTHEDGKYISAKGKDVIVIGGGDTGNDCIGTAVRH
GAKSVVNFELLPQPPNERARDNPWPQWPKVYRIDYGHSEVKARYGKDPRE
YCVMSKEFVSDGGGKVKGINTVRVEWARSSRGGWDMKQVEGSEQFFPADL
VLLSMGFLGPEDRVLGDIERDARKNVKTPPGAYSTSMPGVFAAGDCRRGQ
SLIVWGINEGRQCAREVDQHLMNTTQLPVSGGIVHRAPVTAEILGRAERV
PLQSIAIAAA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4117 hypothetical protein SNOG_01477 [Phaeosphaeria nodorum SN15]1e-119
SY0AAB44YB05FM1 hypothetical protein An07g09920 [Aspergillus niger]2e-98


Manual Annotation:

Please find below the necessary files for GSTUMT00002450001 annotation :

link to GSTUMT00002450001 Artemis file
link to scaffold_136 sequence file
link to scaffold_136ESTs