Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002433001
Length(AA) : 507
Localization : scaffold_132
Number of EST contigs matching the gene: 2
Number of ESTs : 35
  User annotation : Tmeluap  [+]

Blast Results:

Nr Definition: UDP-N-acetylglucosamine pyrophosphorylase
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001592750.1| Score: 1675 E_value: 0.0
KEGG Definition: hypothetical protein [EC:2.7.7.23]; K00972 UDP-N-acetylglucosamine pyrophosphorylase
Accession: mgr:MGG_01320 Score: 1667 E_value: 0.0
KOG Definition: UDP-N-acetylglucosamine pyrophosphorylase
Classification: [Cell wall/membrane/envelope biogenesis].
Kog Number: KOG2388 Score: 1184 E_value: 1e-130
PFAM Definition: UDPGP, UTP--glucose-1-phosphate uridylyltransferase. This family consists of UTP--glucose-1-phosphate uridylyltransferases, EC:2.7.7.9. Also known as UDP-glucose pyrophosphorylase (UDPGP) and Glucose-1-phosphate uridylyltransferase. UTP--glucose-1-phosphate uridylyltransferase catalyses the interconversion of MgUTP + glucose-1-phosphate and UDP-glucose + MgPPi. UDP-glucose is an important intermediate in mammalian carbohydrate interconversion involved in various metabolic roles depending on tissue type. In Dictyostelium (slime mold) mutants in this enzyme abort the development cycle. Also within the family is UDP-N-acetylglucosamine or AGX1 and two hypothetical proteins from Borrelia burgdorferi the lyme disease spirochaete..
Pfam Number: pfam01704 Score: 430 E_value: 7e-43
Swissprot: O74933|UAP1_CANAL
Gene Ontology:
GO:0003977 = Molecular function: UDP-N-acetylglucosamine diphosphorylase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.140NO0.333NO0.161NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1120.0930.828_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00157First60=0.00036PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002433001
MAATVGLGVGNVLNKLSLGSNATEPSPEAVEGLKAKFESISQGHVFTFYD
DLSTPEKAALFEQLSRMDTQRISVITKEALSPPPPAEAPKVEPLPEDATA
SILDSAASDINGWYENGLKLIGQNEVAVVLMAGGQGTRLGSSAPKGCFDV
GLPSRKSLFQLQAERIYKVQELGAKKTGNAKAVVPWYIMTSGPTRGPTEN
FFQENAFFGLSKENVTFFEQGVLPCISNEGKIILESKSKVAVAPDGNGGI
YQALIASGVLADLKTRGIKHVHAYCVDNSLVKVADPVFIGFSASKNVDLA
TKVVRKRNATESVGLIILKNGRPDVVEYSEIDSKTAEARDEKNKDILKFR
AANIVNHYYSTRFLETIPEWVTALPHHIARKKIPYFDTDSGEQKKPEKPN
GIKLEQFVFDIFPRIPLDKFACLEVGREDEFSPLKNARGTGEDDPDTSRR
DVLNQGTKWAKSAGAIIASTEAESGVEISPLVSYGGEGLEFLGGREIKAV
ATIDKGK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1843 UDP-N-acetylglucosamine pyrophosphorylase [Sclerotinia sclerotiorum 1980]0.0
SY0AAD21YH19FM1 hypothetical protein CIMG_07761 [Coccidioides immitis RS]4e-13


Manual Annotation:

Please find below the necessary files for GSTUMT00002433001 annotation :

link to GSTUMT00002433001 Artemis file
link to scaffold_132 sequence file
link to scaffold_132ESTs