Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002352001
Length(AA) : 328
Localization : scaffold_130
Number of EST contigs matching the gene: 5
Number of ESTs : 168
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_07084
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001554496.1| Score: 418 E_value: 4e-39
KEGG Definition: hypothetical protein
Accession: fgr:FG01450.1 Score: 416 E_value: 3e-39
KOG Definition: Calcineurin-mediated signaling pathway inhibitor DSCR1
Classification: [Signal transduction mechanisms
Kog Number: KOG4019 Score: 172 E_value: 3e-13
PFAM Definition: Calcipressin, Calcipressin. Calcipressin is also known as calcineurin-binding protein, since it inhibits calcineurin-mediated transcriptional modulation by binding to calcineurin's catalytic domain..
Pfam Number: pfam04847 Score: 318 E_value: 4e-30
Swissprot: P53806|RCANL_CAEEL
Gene Ontology:
GO:0005515 = Molecular function: protein binding

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.163NO0.471NO0.115NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6110.0680.421M590

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00084First60=0.00037PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002352001
MTFVKWRRLAPKPVDHTAPPTKKEPKKKKSATIQPSTFTTATSHLTPPSN
KDRRPIQTMESPKLSPAVSPLSTPNRSRTSSRGSHLTLDLSSLPPLTQPA
TPTNTLLITNLINPSIFDSPHLQQLRSVIESSATLVSWSPLKSFRRIVCS
FATTEDAISVRQVLDGEAIMGDRARVYFGEHTPVQPVDQHLQAPESKKLF
FISPPPSPPHGWELRNEEPPNAVVVAEDLARALARLDWVRAGKSNTRDSG
VDGASGTEAGGVSPTCRPRSASSVVLFEPEEVGDGEKKMPAISVDDYTDS
GDEASPVSPVAPVSLHTARPPVELIQDA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1353 hypothetical protein BC1G_07084 [Botryotinia fuckeliana B05.10]1e-38
Contig2342 No hit found
Contig7316 hypothetical protein BC1G_07084 [Botryotinia fuckeliana B05.10]2e-30
SY0AAA12YN11FM1 No hit found
SY0AAB23YB02FM1 hypothetical protein BC1G_07084 [Botryotinia fuckeliana B05.10]2e-09


Manual Annotation:

Please find below the necessary files for GSTUMT00002352001 annotation :

link to GSTUMT00002352001 Artemis file
link to scaffold_130 sequence file
link to scaffold_130ESTs