Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002338001
Length(AA) : 606
Localization : scaffold_130
Number of EST contigs matching the gene: 7
Number of ESTs : 163
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein Kpol_397p5
Specie: [Vanderwaltozyma polyspora DSM 70294]
Accession: ref|XP_001643004.1| Score: 1645 E_value: 0.0
KEGG Definition: acetyl-coenzyme A synthetase [EC:6.2.1.1]; K01895 acetyl-CoA synthetase
Accession: ani:AN5626.2 Score: 1271 E_value: 1e-138
KOG Definition: Acyl-CoA synthetase
Classification: [Lipid transport and metabolism].
Kog Number: KOG1175 Score: 1499 E_value: 1e-167
PFAM Definition: AMP-binding, AMP-binding enzyme..
Pfam Number: pfam00501 Score: 717 E_value: 4e-76
Swissprot: P16928|ACSA_EMENI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.017NO0.036NO0.021NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0710.0790.93_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=8.72717First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002338001
MSEAEVSVVSEAHNVETYQVPRKYYEKHPAKPHLTLEEYKAQYRESIENP
DKFWGEKARELLHWDIPFQTVRNGSFQHGDISWFLEGRLNACYNCVDRHA
FKDPERPAIIYEADEPSEGRVITYSELLREVCKLAFVLRQMGVRKGDTVA
IYMPMIPEALVAFLAIVRIGAVHSVVFAGFSAESLRDRVLDARSKVVITT
DEGKRGGKVIGTKRIVDDALKQCPEVKNVLVYRRTGSEVPWTQGRDYWWH
EEVNKYPGYCPPTLMDSEDPLFLLYTSGSTGKPKGGTPAYPDFSRYWDII
EKHGITQFYVAPTALRLLKKAGDHHINKQMKTLRVLGSVGEPIAEDVWKW
YHEKVGRGECHVVDTYWQTETGSHAIAPMAGVTPTKPGSATLPFFGIEPA
IIDPVTGDELHGNGVEGVLAIKRPWPSMARTVWASHQRFMETYLNVYKGY
YFTGDGAGRDHEGYYWIRGRVDDVVNVSGHRLSTAEIEAALIHHEAVAEA
AVVGIADELTGQTVNAFVSLKDSFENSSEMRKSLTLQVRKSIGPFAAPKA
VHVVNDLPKTRSGKIMRRVLRKILSGEEDQLGDTSTLSDPSVVGTILETL
HETGNK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig849 hypothetical protein SNOG_15648 [Phaeosphaeria nodorum SN15]3e-42
Contig1216 acetate--CoA ligase [Emericella nidulans]0.0
Contig3492 hypothetical protein SS1G_05351 [Sclerotinia sclerotiorum 1980]1e-157
Contig3993 acetyl-coenzyme A synthetase FacA [Aspergillus fumigatus A1163]3e-37
SY0AAC17YD08FM1 hypothetical protein SS1G_05351 [Sclerotinia sclerotiorum 1980]1e-118
SY0AAC9YP24FM1 acetyl-coenzyme A synthetase FacA [Aspergillus fumigatus A1163]8e-28
SY0AAD62YM17FM1 hypothetical protein SS1G_05351 [Sclerotinia sclerotiorum 1980]4e-51


Manual Annotation:

Please find below the necessary files for GSTUMT00002338001 annotation :

link to GSTUMT00002338001 Artemis file
link to scaffold_130 sequence file
link to scaffold_130ESTs