Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002325001
Length(AA) : 1545
Localization : scaffold_130
Number of EST contigs matching the gene: 5
Number of ESTs : 10
  User annotation : TmelHUL4  [+]

Blast Results:

Nr Definition: hypothetical protein An01g03470
Specie: [Aspergillus niger]
Accession: ref|XP_001388777.1| Score: 2187 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An01g03470 Score: 2187 E_value: 0.0
KOG Definition: E3 ubiquitin protein ligase
Classification: [Posttranslational modification
Kog Number: KOG0941 Score: 1233 E_value: 1e-135
PFAM Definition: HECT, HECT-domain (ubiquitin-transferase). The name HECT comes from Homologous to the E6-AP Carboxyl Terminus..
Pfam Number: pfam00632 Score: 812 E_value: 1e-86
Swissprot: O94275|MUG30_SCHPO
Gene Ontology:
GO:0000935 = Cellular component: barrier septum
GO:0051286 = Cellular component: cell tip
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.097NO0.207NO0.104NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7830.0440.212M388

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=45.6457First60=0PredHel=2
Topology=(356-378,437-459)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002325001
MSPPLLPSSHSLSSHPRIPSSAIPPHSRKTTISAWGHKYVPTPLHPAAQV
LTTHQESWDTLADEALDLLTLLRIPSPPASPTSPQKDLYTTPKEHHDTHP
TLSTLWQRVDTVPAWVDWEQISRGQDVFYRYSGAMLMGLCYMSLLGGMGA
SRIAEVLYRTGGFSTGTARRRMFETMQHILQCTKSLESIKPGGAGQISSI
KVRLLHAAVRKRILEIERRNPGYYSVKEFGVPVNDLDSIGTVLSFSANMV
WGALPKQGLFLSSREVEDYIALWRLIAHYVGCPTHPFSTSARARAYYDVL
ITTQISPTPTSALLATNILTSLACQPPTYPTRTYLLASTRWLNPPCLCDA
LGLPPVQLSSKILVLAQCILNCYLGYTARFVPWFDKRHGAVARETLWKVI
VLGEIGLGGETGFEFSYVPMLGKGTGAGEAVDTGERGTMGRRSVKVLGIF
LLVVGVLGVVLGWCLVRGAQALWRMTILACLNTHDDNSMPSWPSRLFSTN
NDSDGMMKHGRSRSQQTSASAGWTGSPGRGGGGSASGRGITEGGGGGGGS
RSSNAQFATGHCMCCDCTVRWPSNLNVFRCTVCMTINDLKPVPSGPPGTP
DTPLKEVPPVSLAGTKAIIDTCVEEYLDTRKWIKQMPAYAPPPPPVGGGG
EGSVPGDIPGTPNAFPVFDSRRPLVSFLSRSEGAVMPSTSAPSAMPSVGD
APGSLPGKSGKEKGEGDAKDSGRELAKNMFKRLEDYLFLAFNDWECLNGS
FVKERKDSGGRNKTEGAEIGMSELGSRSRGRREDIAFVTENIGEKEATLL
MGRGRVADARGYNKSERADRSRADAKFSIRSPGIDWDAVNEFYDMITNAG
GDYALERALHRSNSGDKEGDSKELSESLLSRRLGWEDEIMEISAEIEEAR
DNIARILLKATESVLKRPGRPLKKPEEVRFLLVILANPLLYPSFSRASTR
YPSNSSSHSGVGGGPGHNPGIVKRILGLLSNLPNECHHYLVSWFTRMPET
QFRRLIELVGSFITYRLTRQEGRKRSHAGGSAASAGGRLSYNDDWQIRAA
ARVMSLFFSANNNTAGRRGLQGSSYDTADDNLNYGQIARREARRRGQIIP
TSEFYNMLLDYQDLIADFDVWESRASRFCFCQYPFLLSMGAKISILEHDA
KRQMEVQARHAFFNSIASRRTINQYLVLKVRRECLVEDSLKGISEGVGSL
DDIKKGLRIEFIGEDGVDAGGLKKEWFLLVARDVFDPSYGMFVYDDDSQY
CYFNPNSLESSEEFFLVGVLFGLAIYNSTILDVALPPYIFKKLLHFTVPH
SLAVSSIRPPLHHTLEDLAVFRPSLAHGLRQLLEFEGDVESTFCRDFVAE
TERFGQVIRVPLCPNGENRPVTSSNRREFVDLYLNYLLNSSVAKQFEPFK
RGFYTVCGGNALALFRPEEIELLIRGSDEALDVSALKAVAIYDGWGGGNP
AENDPIVKWFWNFFEKITPKEQRMLLSFITGSDRIPAMGATNLIIKVVCL
GQDSNRFPVARTCFNQICLWRYKRREKLEALLWRAVTESEGFGLK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1433 hypothetical protein SS1G_10513 [Sclerotinia sclerotiorum 1980]1e-111
Contig3581 hypothetical protein BC1G_07083 [Botryotinia fuckeliana B05.10]4e-93
SY0AAB13YO12FM1 No hit found
SY0AAC20YH02RM1 hypothetical protein SS1G_10513 [Sclerotinia sclerotiorum 1980]3e-11
SY0AAC59YD04FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]1e-12


Manual Annotation:

Please find below the necessary files for GSTUMT00002325001 annotation :

link to GSTUMT00002325001 Artemis file
link to scaffold_130 sequence file
link to scaffold_130ESTs