Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002312001
Length(AA) : 631
Localization : scaffold_127
Number of EST contigs matching the gene: 1
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_02704
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001793302.1| Score: 1066 E_value: 1e-114
KEGG Definition: Patatin-like serine hydrolase, putative
Accession: afm:AFUA_2G07870 Score: 363 E_value: 1e-32
KOG Definition: Intracellular membrane-bound Ca2+-independent phospholipase A2
Classification: [Lipid transport and metabolism].
Kog Number: KOG4231 Score: 167 E_value: 3e-12
PFAM Definition: Patatin, Patatin-like phospholipase. This family consists of various patatin glycoproteins from plants. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein but it also has the enzymatic activity of lipid acyl hydrolase, catalysing the cleavage of fatty acids from membrane lipids. Members of this family have been found also in vertebrates..
Pfam Number: pfam01734 Score: 158 E_value: 3e-11
Swissprot: Q5XTS1|PLPL8_RABIT
Gene Ontology:
GO:0004622 = Molecular function: lysophospholipase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.187NO0.617NO0.147NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1050.1160.808_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.5168First60=0.11607PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002312001
MAESNLPPLRILSLDGGGVRGLSSLMILQDIMSTISQQEKSSHIRPKDDD
TPLKPCEYFDIIGGTSTGGIIAILLSRLRLDVPACIDIYTQLAEEIFSKD
RSIKIFGTPLRFAGARFSGAVLEKAIKRVLVENSFDPEEKMFDETLTLRE
KEIRRRVDTGQLTKLEVTHSGGVRDVIEKKTWRTSTNSNFSLKPAQDSKP
DPNTHSPQTPKPGCHGIVVAVYKHAVGVPKLFHTNDPDDRKTKIWQALRA
TSAAPTFFDEITFGTPKITYIDGGLGYNSPCAEIDFEAKTRWPGREIGVI
VSIGTGLQTIPAIRRGLRWLPFGLHRELSLAGALVAMATSTARVDNEVQR
MYRDAQTEYYRWDVDSGLGEISLEQWMKEDEMGSVTRRYLDDPDQVIRRQ
KLARTIVGISTKRRVVECSAGRFTVTTIPAGEKAASWSLESLSLPGVPGN
SRAGPIPVLEDLDHDGTRAESQILTCNRALTSSVDLRTLISGVPTGRYKA
RFILRSSIPVSSSSPLRPPGDLILSAGRPYDAKTFTNRFVDRYISLDVVP
ALLYPDAARIRVTAQEWAVRSEQSGNSGWFEVSGDAEVEVCAAGCVGVVV
SCLMRNGGDGEGDDGQICGGWGFGGVRLVPI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1012 hypothetical protein SNOG_02704 [Phaeosphaeria nodorum SN15]1e-109


Manual Annotation:

Please find below the necessary files for GSTUMT00002312001 annotation :

link to GSTUMT00002312001 Artemis file
link to scaffold_127 sequence file
link to scaffold_127ESTs