Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002281001
Length(AA) : 525
Localization : scaffold_126
Number of EST contigs matching the gene: 1
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_08048
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001798375.1| Score: 1585 E_value: 1e-174
KEGG Definition: predicted transporter (major facilitator superfamily)
Accession: aor:AO090005000962 Score: 1557 E_value: 1e-171
KOG Definition: Predicted transporter (major facilitator superfamily)
Classification: [General function prediction only].
Kog Number: KOG0254 Score: 950 E_value: 1e-103
PFAM Definition: Sugar_tr, Sugar (and other) transporter..
Pfam Number: pfam00083 Score: 953 E_value: 1e-103
Swissprot: P49374|HGT1_KLULA

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.492YES0.830NO0.412NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.290.6680.071S423

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=234.864First60=30.8724PredHel=11
Topology=(7-29,49-71,103-122,142-164,177-196,265-287,294-316,326-348,369-391,406-428,435-452)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002281001
MGYRVRNIYAICSFAAIGGGLFGFDISSMAGILGTNAYKNYFGNPLGARQ
GAITSAMPAGSLLGSLVSSYLGDYFGRKQAIQIGGIIWILGSTIQAAAQN
VGMLVVGRIISGICVGITSTIVPVYQSELAPKEVRGRMVSLQQWAITWGI
LIQYFVQYGASFYGGGPTNKHQGPAAFRIPWSIQIIPAAILVGGMFFFPE
SPRWLAVKDRWEQALRVLADVHGNGDLNNPVVLAEYQEIEDIIRFEREEA
ISSFAELAKPRILRRVVLGMSIQMWSQLCGMNVMMYYIVYVMEGAGIGDP
LLTASIQYIINVVMTVPAIIWMDKWGRRPTLLFGSFAMMSLLLISGSIQG
VYGHPETDPSSAITWIMQNKGSQSKAVVACSYLFVATFAITWGPVSWTMP
AEVFPNKVRAMAVSLSTASNWTWNCVLAFAVPPLLRTINWKMYMIFAAFN
CAAFVHMFFTAPETKGVTLEEMDDVFDSGRPPWKTRSPVSRLDNLQKDIA
AGNVKVDIGAATGRRTEIHQVPSKE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig120 hypothetical protein SNOG_08048 [Phaeosphaeria nodorum SN15]1e-174


Manual Annotation:

Please find below the necessary files for GSTUMT00002281001 annotation :

link to GSTUMT00002281001 Artemis file
link to scaffold_126 sequence file
link to scaffold_126ESTs