Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002265001
Length(AA) : 816
Localization : scaffold_126
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: Ankyrin repeat protein
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP48589.1| Score: 1203 E_value: 1e-129
KEGG Definition: hypothetical protein
Accession: ani:AN1130.2 Score: 1042 E_value: 1e-111
KOG Definition: Ankyrin
Classification: [Cell wall/membrane/envelope biogenesis].
Kog Number: KOG4177 Score: 595 E_value: 8e-62
PFAM Definition: No Hit Found
Swissprot: Q9ULJ7|ANR50_HUMAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.086NO0.282NO0.065NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0880.0480.917_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02324First60=0.01477PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002265001
MLQIDTHAGDIGLYLRARLDGDPEFGAMNEELRDDILKVIPEKISAIFLL
VRINMDAIIAEPTIYGRRQVLDRMTDGRGLEDAYSATLERIRQQGRSKAR
LGMQALMWIYHCERPLSPDELCNALGVELGTEDFIIDNVPSWQTVLGSTL
GLVTVGEEDSTVRLLHLTLKEYLGEHPTLFPTAHSMMAEVCLTYLNSWFI
RTLDVHPDTALIRAPFLKYAICSWGTHTATEVTESLKLLAVRLLYGYENH
LSATVFWREKIRKWHWQSDIEGVNGLHCIAYWGIEEIAIAMLDMKKWDIN
SQDSEGCTPLSWALQYGKGKVVELFAEQGEIEPDKVTRSGRTVLSFAAEL
GNESVVELLLERGDVNSGSVDSGGRTPLSYAAGSGRKGVVKLLLERGNVN
ADLADNGGRTPLSYAAESENEGAVKLLLESGNINTDLPDNDGRTPLSYAA
ESGSEDVVKLLLGGGDVNADLPDNDGGAPLSYAAWCGSEDVVKLLLERGD
VNPDLPDNGGRTPLSYAAESGSEAVANLLLEHGDVNTDLPDDDGRTPLSY
TALCRSEGAVKRLLEHGDVNADLADNDGRTSLSYAAKSGSEGAVKLLLER
GHVNADLTDNDGRAPLSYAANYGREGVVKLLLEHGDVNADLPDTDGRTPL
SYAAESESEGVVKLLLERVDVDTDLTDKAGRTPLSYAAESESEGVVKLLL
ESGTINTDLPDNRGRTPLSYAAKSWSKGVVKLLLERGDVNANLTDKAGRT
PLSYAAESRGEGIVKLLLERGDVNANLADKAGRTLLSYAAESGSEGVVKL
LLESGTINTNLPDNGG

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA63YB07FM1 Ankyrin repeat protein [Aspergillus fumigatus A1163]4e-39


Manual Annotation:

Please find below the necessary files for GSTUMT00002265001 annotation :

link to GSTUMT00002265001 Artemis file
link to scaffold_126 sequence file
link to scaffold_126ESTs