Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002261001
Length(AA) : 956
Localization : scaffold_124
Number of EST contigs matching the gene: 3
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: armadillo repeat protein
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP56040.1| Score: 1022 E_value: 1e-108
KEGG Definition: armadillo repeat protein
Accession: afm:AFUA_1G07050 Score: 1016 E_value: 1e-108
KOG Definition: Proteins containing armadillo/beta-catenin-like repeat
Classification: [General function prediction only].
Kog Number: KOG1293 Score: 219 E_value: 4e-18
PFAM Definition: No Hit Found
Swissprot: Q05AL1|ARMC8_DANRE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.095NO0.296NO0.120NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0790.1020.79_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.28772First60=0.03067PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002261001
MTHSEEESTALALLSQLSGSPFSQPQNTLSALKRLKHELIGHEQKKELFV
RLGIVPPLVRILEGTGAADDVWSSARLEAGIAVGSLAYGGENYISHLFDS
QALPPLIASLDPSSSPPKLVLSSLRTLNTILDTSAFSATCPSYAIATALY
TPEVLKNIYKILSQQSLAALVQQQISLTASLIAKSCGRYAPGSSDNSGWH
STHQKLLVDAGVLGALSARLGGHIVAEKSIPKNPKNAHSNDVPPPAPLGA
KLAPILDAISVIIKDSRLRSLEFLFSPPIIAIFPLPTNEPSSPDAPSSSN
KPGEGTVGSTSSINLPQPKLASNSIIQPPNLLITPAAFPPLSAASTISPT
TSKDRILRSAALTATEDGPNRSEVDLDLEVEESPILPWLISQVRSGDSIT
RLMAISVLTNLFKVELVSKKLVQLLILLVLPVLVRLLTEEGRENRVNAGV
GSVDAETWTSWTIREKAPAILARLVMDRAEMQKAAVDAGAIKKLAAMLKR
ANELPSPTMNGHQNGNSHDSNHTAELGSSLEIAHKMKVKEGGLRCLTSLA
LFKDDYRKAIIETGVVPVLVSSMKPLEPISTPAPQKNTVGQGNPPAVLTA
ACGAIRALSRSVSILRTSLIDAGIALPLFALLRHDDIEVRIASTAAVCNL
VLHFSPMRRPILEAGVLDVLCSHAKSENAALRLNALWALKHLVLEAETDV
KRKCFEGLGVDWLLGVIRGMEDSIGDLRRMSAGRTGDEEYFDAPEERIRS
WARRFPPKATAVMAQLERRERDDSLRRRKEDIALQEQGLDFLRNWIGGKD
RNLMIDHLFESVGKDRVFEILEDKLKQKRYVKRGELISESPPGEIVTSVV
YILVHLATGSLPHKRALIQRVDLLRTLCALWNHRLPHVRTGLAWVVINLT
WREEHEDIEEVHARARELIRLGFDKSLESMSQDSELDVRERVKTARHQLS
TVGPAD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig7319 hypothetical protein CIMG_02457 [Coccidioides immitis RS]1e-26
SY0AAA52YI21FM1 unnamed protein product [Aspergillus oryzae]2e-07
SY0AAC7YI17FM1 hypothetical protein SNOG_01284 [Phaeosphaeria nodorum SN15]4e-10


Manual Annotation:

Please find below the necessary files for GSTUMT00002261001 annotation :

link to GSTUMT00002261001 Artemis file
link to scaffold_124 sequence file
link to scaffold_124ESTs