Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002251001
Length(AA) : 509
Localization : scaffold_124
Number of EST contigs matching the gene: 3
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001209466.1| Score: 539 E_value: 7e-53
KEGG Definition: hypothetical protein
Accession: ang:An07g09810 Score: 526 E_value: 1e-51
KOG Definition: Peroxisomal NUDIX hydrolase
Classification: [Replication
Kog Number: KOG3069 Score: 185 E_value: 2e-14
PFAM Definition: NUDIX, NUDIX domain..
Pfam Number: pfam00293 Score: 144 E_value: 9e-10
Swissprot: O13717|YDZA_SCHPO
Gene Ontology:
GO:0005783 = Cellular component: endoplasmic reticulum
GO:0005794 = Cellular component: Golgi apparatus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.175NO0.553NO0.152NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1270.170.737_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=27.3201First60=0.0745PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002251001
MATKASLFSPYTDLLGHISPCPCIVSYSSSLHRHLETPSPTKPPTISNTI
LRLLFHHSIVIITSSHLISHTIRPHRSIGSTTPRPLPDPIFSCPPRYKEQ
DLKRMAPKDLILGLHRALEELTENPPPSVPSPEGTPKRASVALVVRVQPH
PSHLPASIDNYQVGGLSEFFEQPWVKRGDPECLFIKRAARKGDRWTSHVA
LPGGKRDGEDEDDHRAAVRECLEEVGLVLDDGMIIDCGKLPDRVVNYRLM
VLCPFVFLYTSPTAPSFTLQPTEVASAHWVPIRTLISPVFRTVQTCDVSD
RLSRRFSGLLESIVRWGLRVNLGQMEFAAVRLWPSISIFSSFSGDFLDGT
EAGGRSWDRPLLLWGLTLGVVTDFLEMLPRGERAAGWKYPTFXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLCGRAVIASTALGAV
AWRYWYTRR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig6133 hypothetical protein An07g09810 [Aspergillus niger]8e-26
SY0AAA20YC20RM1 No hit found
SY0AAB20YK19FM1 NUDIX family hydrolase, putative [Aspergillus fumigatus A1163]6e-07


Manual Annotation:

Please find below the necessary files for GSTUMT00002251001 annotation :

link to GSTUMT00002251001 Artemis file
link to scaffold_124 sequence file
link to scaffold_124ESTs