Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002245001
Length(AA) : 893
Localization : scaffold_124
Number of EST contigs matching the gene: 3
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU10077
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_957865.1| Score: 268 E_value: 4e-21
KEGG Definition: hypothetical protein
Accession: ncr:NCU10077.1 Score: 268 E_value: 2e-21
KOG Definition: No Hit Found
PFAM Definition: SAE2, DNA repair protein SAE2. SAE2 is a protein involved in repairing meiotic and mitotic double-strand breaks in DNA. It has been shown to negatively regulate DNA damage checkpoint signalling..
Pfam Number: pfam08573 Score: 192 E_value: 4e-15
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.131NO0.264NO0.103NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1770.1140.701_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00018First60=0.00018PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002245001
MDILGRHRIAFNNLGVQLFADLERDLAPVLTKGLGEKADLERVIAEQKEL
LQERQALVDAYQSASEQQQQKIREQENRLQSLGYGIAKTEIENEALVERL
EEIEKADRERQRRALAITKDKSLENKENIPPVFNYLAQNTPSRTLTRPVS
PPPKPLNKPRIPSSTPAGGATRTLFSYKDGEVQTDPIYSLDDLKKAYQEL
ASSYNDIHYELDQYKEAYSRLAEKYAQNKAVWKQWSEQENTRLINSKKRR
LEEGTTELRAVGRRINGYTTPATSITGGSPTSRAPNISPIKPRFRPSVVH
SSPKNGGLFHELLESGAGMAGEVKGSFELVGGKGLVGGGPKEGSVELPSS
PLSSPPSSLSTPETQVPSRTLGATRNSKSRDDGDSTESDDEPRPSNRCND
ALESVIPSRDSAFKIPVVKEETGACGRGRISQEGDSMARPVVIKSESHTS
SEGLGYHMFDQESLDLDDIGQKPQTPRKRQKPRYPELGASENIGRLGWIS
GGFRIAPTGDTGEAQDAENDLPVPIFPPSAVGEGKPVGIWPDSQLVRPTT
PVQTAGAGPRSSFPISAENEGSKTHPPLRRSSRTSATRKTLSPTTKAKKL
NAHSPPKAKKRRMATSRAIASLAEDGTDGCEDINTSSIHPPMVLSEKQRK
QLERDMKGTTRLDDILNSPASRTPNLARLKKSIQSRTSPVRKRTWGGDGF
GAPQVRPPSSAGPSTSAWRAGGNMKSKARDISSTLDISDFRVNPEVNDGK
DYAFAETVRNRDARKCLPGCMKTCCRDLVGFTEAAGLPAVSKGPRWRSSS
PAPVDGCDLPRRNPRKESVSREDKAKEFTNRYGRHRDAFERRRSPPGFWD
ADFPTTPELEQQRVVAEEMRRKKVEDMRKEAGKGNKGRYVYRD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1707 No hit found
Contig2759 hypothetical protein NCU10077 [Neurospora crassa OR74A]9e-14
SY0AAA45YG23FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00002245001 annotation :

link to GSTUMT00002245001 Artemis file
link to scaffold_124 sequence file
link to scaffold_124ESTs