Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002230001
Length(AA) : 273
Localization : scaffold_124
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein NCU00693
Specie: [Neurospora crassa OR74A]
Accession: ref|XP_965833.1| Score: 467 E_value: 6e-45
KEGG Definition: hypothetical protein
Accession: ncr:NCU00693.1 Score: 467 E_value: 3e-45
KOG Definition: Exosomal 3'-5' exoribonuclease complex subunit Rrp40
Classification: [Translation
Kog Number: KOG1004 Score: 413 E_value: 3e-41
PFAM Definition: No Hit Found
Swissprot: Q08285|RRP40_YEAST
Gene Ontology:
GO:0000177 = Cellular component: cytoplasmic exosome (RNase complex)
GO:0000176 = Cellular component: nuclear exosome (RNase complex)
GO:0000175 = Molecular function: 3'-5'-exoribonuclease activity
GO:0006402 = Biological process: mRNA catabolic process
GO:0042255 = Biological process: ribosome assembly
GO:0006364 = Biological process: rRNA processing

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.135NO0.353NO0.100NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1460.0530.872_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03933First60=0.00118PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002230001
MSLVVQVRFPGETLPPLEDEKKNTTFKVGPGLTHISPSTLIVSRAGELNI
DQRKHTIWMESNSKRYVASQNDAIIATVLRSTADSYICAIPSSNSPVPSA
SQAVLPHLAFPQATKKTRPVLHQGSVVYARISLANKHIDPELECYDADSG
KSEGFGELKGGFVFGVSLGMARRLLGDAKKTRLLRVRERKAEAGRKGEEY
QDVGVDMSSGREVLEELGESLSFELAVGRNGRIWVHSGDPKTTLCVMRCI
QQSEFLTGKEQRQLVKEALKALG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1286 hypothetical protein NCU00693 [Neurospora crassa OR74A]7e-40


Manual Annotation:

Please find below the necessary files for GSTUMT00002230001 annotation :

link to GSTUMT00002230001 Artemis file
link to scaffold_124 sequence file
link to scaffold_124ESTs