Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002175001
Length(AA) : 648
Localization : scaffold_134
Number of EST contigs matching the gene: 3
Number of ESTs : 16
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein FG00573.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_380749.1| Score: 977 E_value: 1e-103
KEGG Definition: hypothetical protein
Accession: fgr:FG00573.1 Score: 977 E_value: 1e-104
KOG Definition: No Hit Found
PFAM Definition: Fungal_trans, Fungal specific transcription factor domain..
Pfam Number: pfam04082 Score: 218 E_value: 3e-18
Swissprot: P49413|UAY_EMENI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.181NO0.368NO0.180NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6570.0370.364M427

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.30776First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002175001
MSNSASDLSAPLLRVSRPVSACSRCRSAKVKCDGKLPACTACEKSGKANE
CTGGSDQFARGKERSYIAWLESKVEKLEKELATLESRKAPSGSMGGNGAG
GGDSRLTHPQQDLRRDRRIATPGSPLPNGARAKTKKREEANEIEDLVADL
GYMAINATTRDFYGFARDMTFAKVVLKASTASKALESKPRARLPPRHTAT
QLIQHYFDRIFTTLPCLNEASFFGAVDSVYRDESTCSPYDIYTVYMVLAI
GTMSLSKSRDSPAAHNAACFVKSALEHADAVISPSAITGVQAALLLVQYS
MLEPAHFNSWYLIGIASRIMVDLGLHQEPTKSLRKKSADMDLRRRIFYCV
YTLDRSISMALQRPFTFSDDSVLVDLPKLEDPKVAKQIIVRGTLTPMAAA
IHLFRLRKLQSEWYQFLHLSGSEPVQDSMAYFRSKTAILKEWLGKIPESI
NNSTRDWLYLEWYYLNVYTAAPCPKIPRPCDEAIVQVFQNCVNYALMFRS
ILQNSNVRFVYTYHDALRTYFIGNNFLHALWRSEDTIITSANVTSTIDAI
KAIIFVLTSMIVRWQEVEALRDKFRGESSYMLGNLEARQQTLLVPPRPRV
TREEAERVLRHQLSIEWGEIDSFNPQLYNPSGHIAMADFGNVAFYRYA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1330 hypothetical protein FG00573.1 [Gibberella zeae PH-1]1e-103
Contig6229 hypothetical protein BC1G_04622 [Botryotinia fuckeliana B05.10]6e-18
SY0AAD30YF15FM1 hypothetical protein BC1G_04622 [Botryotinia fuckeliana B05.10]2e-16


Manual Annotation:

Please find below the necessary files for GSTUMT00002175001 annotation :

link to GSTUMT00002175001 Artemis file
link to scaffold_134 sequence file
link to scaffold_134ESTs