Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002174001
Length(AA) : 527
Localization : scaffold_122
Number of EST contigs matching the gene: 2
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_07585
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001590961.1| Score: 876 E_value: 6e-92
KEGG Definition: hypothetical protein
Accession: ncr:NCU07985.1 Score: 784 E_value: 1e-81
KOG Definition: Monocarboxylate transporter
Classification: [Carbohydrate transport and metabolism].
Kog Number: KOG2504 Score: 208 E_value: 4e-17
PFAM Definition: Nodulin-like, Nodulin-like. This family represents a conserved region within plant nodulin-like proteins..
Pfam Number: pfam06813 Score: 248 E_value: 9e-22
Swissprot: Q03795|YM30_YEAST

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.725YES0.933YES0.551YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4260.2880.085M541

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=225.03First60=30.9927PredHel=10
Topology=(13-35,50-69,76-93,103-125,138-160,170-192,300-322,374-396,403-425,483-502)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002174001
MPERHLRIARFVSLAASTCISLACGTNYVYSAYAPQLATRLHLTATESNL
IGTFGNLGMYLSGIPSGILVDSKGPRLPLLIGAAALLIGYYPMYLAMEGG
KGSTNVFALCFFSALTGVGSCCAFGGAMKAAALNFPQNRGTATALPLAAF
GLSAFFFSFISSWLFPGNTSDFLLVLCLATSSIVFISFFFLRVIPVPRAY
SAIPPLDIPRGNRLRRTKSGEDRHSPVMSSYVEPGTSTTSHDTIVAVANP
DPMPDESSSFLTKSSSSGGSEENRVDAESNYGQAVGNSDIHIDIRGWALA
YKPEFWLLFSLLGLLTGTGLMTINNIGHSVQALWAKFAPDEHPDYVQGQQ
SLHVSILSLCSFCGRMLSGVSSDIIHRKYGLQRLWLIVASASIFSLAQLC
ALTVENPNWLWLVSSLSGLGYGVLFGVYPTIISEEFGLHGLSQNWGTMTV
SAVISGQIFNIFYGRVYDDHSVITPEGPRECNLGLECYRSSYWITLGAAL
LGLVTALGTIQRHRRRSGYASISTHSA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3155 hypothetical protein SS1G_07585 [Sclerotinia sclerotiorum 1980]6e-49
Contig3909 hypothetical protein SS1G_07585 [Sclerotinia sclerotiorum 1980]2e-31


Manual Annotation:

Please find below the necessary files for GSTUMT00002174001 annotation :

link to GSTUMT00002174001 Artemis file
link to scaffold_122 sequence file
link to scaffold_122ESTs