Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002132001
Length(AA) : 191
Localization : scaffold_122
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_07739
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001591114.1| Score: 359 E_value: 1e-32
KEGG Definition: hypothetical protein
Accession: mgr:MGG_10832 Score: 347 E_value: 1e-31
KOG Definition: No Hit Found
PFAM Definition: SPC25, Microsomal signal peptidase 25 kDa subunit (SPC25). This family consists of several microsomal signal peptidase 25 kDa subunit proteins. Translocation of polypeptide chains across the endoplasmic reticulum (ER) membrane is triggered by signal sequences. Subsequently, signal recognition particle interacts with its membrane receptor and the ribosome-bound nascent chain is targeted to the ER where it is transferred into a protein-conducting channel. At some point, a second signal sequence recognition event takes place in the membrane and translocation of the nascent chain through the membrane occurs. The signal sequence of most secretory and membrane proteins is cleaved off at this stage. Cleavage occurs by the signal peptidase complex (SPC) as soon as the lumenal domain of the translocating polypeptide is large enough to expose its cleavage site to the enzyme. The signal peptidase complex is possibly also involved in proteolytic events in the ER membrane other than the processing of the signal sequence, for example the further digestion of the cleaved signal peptide or the degradation of membrane proteins. Mammalian signal peptidase is as a complex of five different polypeptide chains. This family represents the 25 kDa subunit (SPC25)..
Pfam Number: pfam06703 Score: 252 E_value: 7e-23
Swissprot: Q04969|SPC2_YEAST
Gene Ontology:
GO:0005787 = Cellular component: signal peptidase complex
GO:0005515 = Molecular function: protein binding
GO:0045047 = Biological process: protein targeting to ER
GO:0006465 = Biological process: signal peptide processing

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.053NO0.424NO0.051NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1120.140.82_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=43.5363First60=18.8579PredHel=2
Topology=(42-64,69-91)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002132001
MAAKPKANLHALPELKNTSDDSIALYLKSKGWKQNHTLTDVRLVLGFSAV
IIAGGTFYYDYTLGFDKTKVMTLYAVIAYFVANIILTWWIWGMESGKVYV
GSKDGVTITISSHTEKHSPIYHLKIVSRSPGQRPTTTEVESPFTSWFDTQ
GFLVEKPFMTFISNSIPSMAATTPEGQHLKSKPKPKSTKKA

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB9YF17FM1 hypothetical protein SS1G_07739 [Sclerotinia sclerotiorum 1980]1e-32


Manual Annotation:

Please find below the necessary files for GSTUMT00002132001 annotation :

link to GSTUMT00002132001 Artemis file
link to scaffold_122 sequence file
link to scaffold_122ESTs