Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002110001
Length(AA) : 1042
Localization : scaffold_125
Number of EST contigs matching the gene: 3
Number of ESTs : 6
  User annotation : TmelBem2  [+]

Blast Results:

Nr Definition: hypothetical protein
Specie: [Yarrowia lipolytica]
Accession: ref|XP_506119.1| Score: 1260 E_value: 1e-136
KEGG Definition: hypothetical protein
Accession: yli:YALI0F32043g Score: 1260 E_value: 1e-136
KOG Definition: Predicted Rho GTPase-activating protein
Classification: [Signal transduction mechanisms].
Kog Number: KOG1450 Score: 347 E_value: 5e-33
PFAM Definition: RhoGAP, RhoGAP domain. GTPase activator proteins towards Rho/Rac/Cdc42-like small GTPases..
Pfam Number: pfam00620 Score: 349 E_value: 3e-33
Swissprot: Q9HF75|BEM2_ASHGO

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.100NO0.257NO0.068NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0850.0630.915_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.02793First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002110001
MLRAIRDVAGVGQQLFYSKDGELVLKSITDDAITSRPSSVIETTSKRVSG
ASRRISAQFYGDTASPRMPEQLDGSMPPTPAREEFALDNRRCLPVVPKGG
TLERLVDILVLGVEDFSRRMNGSDPVFTAENAPLLRMNMDVFTITFFATF
RSYCSPIVLIDYLKKRLLGSKSAATISDNESDDVVFPDWTGVDHVSDESI
DWNLVAKIHMGILEAVNTWISEFFIDFHCDQSLGDSFMSFLAIASKELAY
WKHLGPEHGYLRRQADQINSLWYDVRGKFSNLNFLPLRYPTQRMSSPRGS
LQIPPLTDIPAIEGFVNSLEAKVLESFRMVKLVDWMTAFEIFETQSSESL
GFFVPKVALLFHDDDEVLQDIFFVLRNVRRGNLAVTLLETLPRPLRELCN
LRSDITGWVLAQIVDPQLNADRRAHRIATLLRCLTISRKRMSGMDLYEDT
RGGARQQVPSFVASVIAAALTRPESRVFSYAWMMGVRMTAGAVTQIDTLE
QVIVEELEGIRSSKPLTPCVGWIIERLLEIVCYVPNMVVENNRLINFDKR
RYVYNFVNNFTHVGSEKSVDEHLSVCTDVSLSYLRLPEMRTLRELAAKEN
HPIRQSRVKVFWKLLHHEQEKLRRDAKQRDAIERQQRQQLRAEHRRQPTA
PNPQPADKKSNKRLGVNSIFRAVRPISMALTGWTPPQSSARTVAPTDLPA
LKAIEHGKKPSITIDLASVASVSCPKTTRDRHIWKVRTDQGVSYLFQALS
EKDLEGWLRTIASIRGINATDTTESIDGLTVVSQNRVPQPVFGVSLDDLC
RRDHVKVPIVVEALLSEIETRGIDEVGIYRVPGSLSSINALKNALDSGEE
VRMDDDRWYDINAIAGAFKLLMRELPDKALGDEALYELRNITSDITDDDQ
RALAFREIMLRLPVNNYNFLRRVYTHFARIATNAAINKMHAVNLAIVFGM
GLSPGSLNMPLGVSPDLGLYQTMVKVWITHAELVFPEVEDYEDRESASVS
KAESVEIQSSEPSSPAIEYSSPRMSLDDSRPHLYAESDKGFV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig940 hypothetical protein [Yarrowia lipolytica]1e-68
Contig4137 hypothetical protein [Yarrowia lipolytica]2e-18
SY0AAD23YM15FM1 hypothetical protein [Yarrowia lipolytica]5e-11


Manual Annotation:

Please find below the necessary files for GSTUMT00002110001 annotation :

link to GSTUMT00002110001 Artemis file
link to scaffold_125 sequence file
link to scaffold_125ESTs