Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002048001
Length(AA) : 389
Localization : scaffold_360
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein MGG_06324
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_369809.2| Score: 1393 E_value: 1e-152
KEGG Definition: hypothetical protein [EC:4.2.1.46]; K01710 dTDP-glucose 4,6-dehydratase
Accession: mgr:MGG_06324 Score: 1393 E_value: 1e-152
KOG Definition: Putative NAD+-dependent epimerases
Classification: [Carbohydrate transport and metabolism].
Kog Number: KOG0747 Score: 995 E_value: 1e-108
PFAM Definition: Epimerase, NAD dependent epimerase/dehydratase family. This family of proteins utilise NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions..
Pfam Number: pfam01370 Score: 477 E_value: 1e-48
Swissprot: Q9LH76|RHM3_ARATH

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.084NO0.158NO0.054NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4380.0580.539_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.8279First60=1.82086PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002048001
MVPNRSVTHRHFQDTGIWRDAPVYKGATKFPPLEDAKNILITGGAGFIAC
WLVRHLTLTYPEYNIISYDKLDYCASLNNTRCLSTAPNFTFVHGDITSPE
EVQNAFRKYNIDTVFHFAAQSHVDLSFGNSYEFTSTNVYGTHVLLECAKN
HGSLKRFIHISTDEVYGEVDEDGEDLIEQSILAPTNPYAASKAAAEMLVH
SYYKSFKLPVIIVRSNNVYGPHQFPEKVIPKFSCLLHRGEKLLLHGDGKH
TRRYLFAGDAADAFDTILHKGLIGQIYNVGSTDEISNLELCALLLKQFGH
DPAVDFDSFVEHTIDRPFNDRRYAVDATKLKSLGWVQKTTFAEGLKATVD
WYRKFGSEWWGNIDLVLVPFPVVKDSEVVDADNSGSKSS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1217 conserved hypothetical protein [Sclerotinia sclerotiorum 1980]2e-65


Manual Annotation:

Please find below the necessary files for GSTUMT00002048001 annotation :

link to GSTUMT00002048001 Artemis file
link to scaffold_360 sequence file
link to scaffold_360ESTs