Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001944001
Length(AA) : 535
Localization : scaffold_318
Number of EST contigs matching the gene: 1
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: mRNA capping enzyme, beta subunit, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001267171.1| Score: 734 E_value: 2e-75
KEGG Definition: mRNA capping nucleoside-triphosphatase, putative
Accession: afm:AFUA_4G08510 Score: 733 E_value: 1e-75
KOG Definition: Vesicle coat complex COPII
Classification: [
Kog Number: KOG0307 Score: 180 E_value: 7e-14
PFAM Definition: mRNA_triPase, mRNA capping enzyme, beta chain. The beta chain of mRNA capping enzyme has triphosphatase activity. The function of the capping enzyme also depends on the guanylyltransferase activity conferred by the alpha chain (see pfam01331).
Pfam Number: pfam02940 Score: 436 E_value: 1e-43
Swissprot: Q9P6Q6|CET1_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0042803 = Molecular function: protein homodimerization activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.052NO0.199NO0.043NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.10.0830.9_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00718First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001944001
MMDLDGGSGVTPGPVLGPGQKWGSPVMERAKPNGTISVDSRDSQGSHHLA
PQQQQPQPTQLPSTSNSNSNLSQQPSSQPSSGASSQRTSTVSPSNKEQPH
PPPSTLTPQTKKSTPTPTNISPRHPPPQPSSSPKGAHQLGPPPTPSQNQA
IVEGGTSSSPGSSGPPKKRARRDEAPIWARKASRSSSSSPVLANRRQPSS
ANQHQPPLQQQPPPLPPPPPQQHQKPPPASGFTPRFVPCFGAWEPSICNT
EPYEELTREVANFLFNQVVCQNDPALTSSGGDGPVVMIEIEAKIGHLIDK
ERGERLKLPVVTETVLNVDEPGWKIQFKSSMTEVILLFIYLFSSTPTRGA
NSRPPAGPQRIPMDYVHTRERDTFFELPPDKFQALPNILRSYMRHKPKVR
VTIDQKTGKVINKIIKTRIADLNVYSPKTAFDWRVSANIEMPYPGDIDGL
QPSSDRGGGDRNKDRLSYRHLAYQIDLTQVTDNTARKEHELEVEVSGQEI
IRHGNLAREKKPNAYEYLVRGFVDNVRVLIRAIEP

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4531 mRNA capping enzyme, beta subunit, putative [Neosartorya fischeri NRRL 181]5e-77


Manual Annotation:

Please find below the necessary files for GSTUMT00001944001 annotation :

link to GSTUMT00001944001 Artemis file
link to scaffold_318 sequence file
link to scaffold_318ESTs