Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001930001
Length(AA) : 743
Localization : scaffold_320
Number of EST contigs matching the gene: 1
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001244777.1| Score: 2688 E_value: 0.0
KEGG Definition: conserved hypothetical protein
Accession: fgr:FG09528.1 Score: 2594 E_value: 0.0
KOG Definition: ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b
Classification: [Amino acid transport and metabolism
Kog Number: KOG0062 Score: 1861 E_value: 0.0
PFAM Definition: ABC_tran, ABC transporter. ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide, or belong in different polypeptide chains..
Pfam Number: pfam00005 Score: 344 E_value: 1e-32
Swissprot: O59672|YB89_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.051NO0.162NO0.045NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0370.2280.879_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03492First60=0.01399PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001930001
MEAEITAVLPSIDPIITDYSVGFLTHASTSTSPEADIEFAEAISAVTSIL
LDAAPPSVSEASVTGLIDKLVAQLNAAHGENRRAFSGRAKKLDQTIHMAS
QKNISSTMGLVGGGVDIDAVGTRKVESKVDKKKLEKAERKIKAKQDKKVM
KNVTYEASKLIATDEQQSYDDFYMAVNPLQLGQSSQGKSKDIKIDNVDVQ
IGGKRILSDTTLTLAYGRRYGLVGQNGIGKSTLLRALSRREVAVPTHITI
LHVEQEIMGDDTPALQAVLDADVWRKHLLAEQDRISKELKILESKPDPIT
ITASQGFPNQERDELDSLLSEVHAKLAEIESDKAEPRAASILAGLGFSAE
RQQDPTRTFSGGWRMRLALARALFCKPDLLLLDEPSNMLDVPSITFLSEY
LQDYPSTILVVSHDRAFLNEVATDIIHQHSERLDYYKGGNFDSFYATKEE
RRKTAKREYENQMAYRKHLQTFIDKFRYNAAKSSEAQSRIKKLEKLPVLE
APEDEYSVVFKFPDVEKLSPPIIQMQNVSFSYTPGKPIVEKVDLDVQLDS
RIGIVGPNGAGKTTVLKLLIGQLSPSSGLITQNPRLRIGFFAQHHVDALD
LNSSAVAFCAKMFPGRTDEEYRRHLGAFGITGTTGLQKMALLSGGQKSRV
AFACLSLTNPHILVLDEPSNHLDVEAMDALSNALRNFHGGVLMVSHDVTM
LANVCTHLWVCDNGSVESFPGDIKAYKKRIIEQANAAGVVKHH

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1615 conserved hypothetical protein [Coccidioides immitis RS]0.0


Manual Annotation:

Please find below the necessary files for GSTUMT00001930001 annotation :

link to GSTUMT00001930001 Artemis file
link to scaffold_320 sequence file
link to scaffold_320ESTs