Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001907001
Length(AA) : 674
Localization : scaffold_309
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An01g00070
Specie: [Aspergillus niger]
Accession: ref|XP_001388459.1| Score: 1230 E_value: 1e-133
KEGG Definition: hypothetical protein
Accession: ang:An01g00070 Score: 1230 E_value: 1e-133
KOG Definition: tRNA methyltransferase
Classification: [Translation
Kog Number: KOG1253 Score: 1070 E_value: 1e-117
PFAM Definition: TRM, N2,N2-dimethylguanosine tRNA methyltransferase. This enzyme EC:2.1.1.32 used S-AdoMet to methylate tRNA. The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs. The enzyme is found in both eukaryotes and archaebacteria.
Pfam Number: pfam02005 Score: 921 E_value: 1e-100
Swissprot: Q9P804|TRM1_SCHPO
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.202NO0.511NO0.210NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.890.0180.203M236

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01093First60=0.00005PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001907001
MTPSFLVGSTLRPHSHSLNLRVLSPTGFAKIHSRAFSKYSTLLNSDHHSQ
KLPSHPQTPAPAATTRMGKRKRTPNQGPIAPNPAPAHAFPVTLEDGTECT
AVREGLATVLFPRFVAKKDKSGNDLVDGQVFYNPVQQFNRDLSVLAIRAF
GEVFLREKKAKKAAKMKGDEDERPMKADIPPKFSILDALSATGLRALRYA
LEIPFVTHTTSNDLDPSASQSIRRNIHFNKTHTTKTVDPALTPDAALSKI
QSRDYPSSKYDVIDLDPFGTAVPFLDAAVQAVSDGGLLCITCTDAGVWAS
MGYSEKCFSLYGGMPIKGEWSHEAGLRLILYATATTAARYGFSIEPLLSL
SIDFYARVFVRVRKSPREVKKLASTSMIVYNCDSGCGSWRTQSLGKRKEE
KNKNGDGTYLKFGLAMAPTTSSECPDCGFPMHLGGPMWSGPLHSPTFITH
LLSALPAQPPEIYQTLPRITGMLQTALQESTLPNSPFFFVTNCLARTLHC
EAPPLAAFRGALMRLGYTVVRSHCKPTSVKTDAPWSLIWEVMRRWVRQKP
AGQGKVGGAMAGYKILKFGIKENADNGEGSAREKWRAEKEKEEMERLTAL
EIVFDEGLGKDKDRVKGVVRYQVNPTANWGPLKRGRGVEALIGETTAVEE
GGGGELVERGEESDEEGRVSKEAR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1862 hypothetical protein An01g00070 [Aspergillus niger]6e-10
Contig7528 hypothetical protein SS1G_12965 [Sclerotinia sclerotiorum 1980]5e-76


Manual Annotation:

Please find below the necessary files for GSTUMT00001907001 annotation :

link to GSTUMT00001907001 Artemis file
link to scaffold_309 sequence file
link to scaffold_309ESTs