Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001906001
Length(AA) : 266
Localization : scaffold_315
Number of EST contigs matching the gene: 4
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001543500.1| Score: 592 E_value: 2e-59
KEGG Definition: hypothetical protein
Accession: ncr:NCU09543.1 Score: 527 E_value: 3e-52
KOG Definition: Predicted membrane protein
Classification: [Function unknown].
Kog Number: KOG2913 Score: 133 E_value: 8e-09
PFAM Definition: No Hit Found
Swissprot: Q80XM9|PQLC1_MOUSE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.747YES0.977YES0.633YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0390.8940.053S125

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=89.6678First60=39.5572PredHel=4
Topology=(3-25,40-59,66-88,134-153)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001906001
MGFFGVLVSYVAPLFIVTSPLTSYADQIRNIHVTKSSRGFSLDTPLIMLI
ASILRCFYWLGADFETSLLIQSIIMIFVQLLLLKVALDYRPPSYPPLSPP
TPTASPTSTSHSPPFPPYPPAPRPYNFWQWPTQKPYWSFLLYFSLITLTL
HLLFGSSQLFIDMVGYLALGVEATLPIPQVLSNQSSRSCDGFRLSVLASW
LLGDVMKILYFFSAEHVSVQFKLCAGVQFTLDTYLGVQSWMFGSGVGEGV
RRWELEMVERGEMRLA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1103 conserved hypothetical protein [Ajellomyces capsulatus NAm1]9e-24
SY0AAA36YC24FM1 conserved hypothetical protein [Ajellomyces capsulatus NAm1]3e-24
SY0AAA4YH18FM1 hypothetical protein BC1G_02579 [Botryotinia fuckeliana B05.10]1e-28
SY0AAD17YA16FM1 conserved hypothetical protein [Ajellomyces capsulatus NAm1]3e-15


Manual Annotation:

Please find below the necessary files for GSTUMT00001906001 annotation :

link to GSTUMT00001906001 Artemis file
link to scaffold_315 sequence file
link to scaffold_315ESTs