Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001860001
Length(AA) : 276
Localization : scaffold_299
Number of EST contigs matching the gene: 6
Number of ESTs : 78
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_08769
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001552291.1| Score: 626 E_value: 2e-63
KEGG Definition: hypothetical protein
Accession: ncr:NCU06977.1 Score: 625 E_value: 1e-63
KOG Definition: No Hit Found
PFAM Definition: DUF1774, Fungal protein of unknown function (DUF1774). This is a fungal family of unknown function..
Pfam Number: pfam08611 Score: 318 E_value: 3e-30
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.458NO0.983YES0.566YESN

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2040.4440.468_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=150.76First60=22.3603PredHel=7
Topology=(20-42,64-86,99-121,143-165,178-197,201-220,227-249)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001860001
MAFSNPFSRDIEGTSRNIPAYRAFTIISWLLFFVVAIVYSISPPHDGHWA
TGTIFGISKAHITPFTLSHAFVAIYWVFLFCSQISFVAQLFRRDEAAVTA
AASVGSHFILFNLLQFGWIMLWTRSLFFWSDWSCYTFATLPHQGILVHVP
AAAMPLTWSFFLVFWNGSVMVGCHSLPCHVIANIAIWGIAVFAGFFLLVF
KDYHVGFATTFLTAGLGVGQFFAKIIALQWIFAFTIMAIVFLFSLAVAIP
GIYGRETGVEARGGDRERAPLLHESN

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2023 hypothetical protein BC1G_08769 [Botryotinia fuckeliana B05.10]8e-69
Contig2359 hypothetical protein NCU06977 [Neurospora crassa OR74A]2e-52
Contig3970 hypothetical protein NCU06977 [Neurospora crassa OR74A]1e-28
Contig4489 hypothetical protein NCU06977 [Neurospora crassa OR74A]7e-31
Contig6450 hypothetical protein NCU06977 [Neurospora crassa OR74A]2e-44
SY0AAC17YJ19FM1 hypothetical protein NCU06977 [Neurospora crassa OR74A]1e-39


Manual Annotation:

Please find below the necessary files for GSTUMT00001860001 annotation :

link to GSTUMT00001860001 Artemis file
link to scaffold_299 sequence file
link to scaffold_299ESTs