Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001852001
Length(AA) : 804
Localization : scaffold_296
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: Ankyrin repeat protein
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP48589.1| Score: 1031 E_value: 1e-109
KEGG Definition: hypothetical protein
Accession: ani:AN1130.2 Score: 730 E_value: 4e-75
KOG Definition: Ankyrin
Classification: [Cell wall/membrane/envelope biogenesis].
Kog Number: KOG4177 Score: 513 E_value: 2e-52
PFAM Definition: No Hit Found
Swissprot: Q9ULJ7|ANR50_HUMAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.084NO0.733NO0.094NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0520.1030.945_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.39169First60=0.00071PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001852001
MTDGSDLKDVYGATLERIQEQGGEKARLGMAALMLISHSKRVLQLDELLH
ALAVEKRSTDLDSDMVPSAEILLSCFLGLVVIDREASVVRLIHLTLQEYL
YTRPNLFGATHSIMAETCLTFLNFHALKEISPALFAPPPQSTPFLEYSSL
YWGVHAERGASRDVVSLALKLFSPIETHISTKLLLLDILSRAGRYNLEIP
PNGHLIGFSGLHCVSVFGIVEIANALIGQPNYDLNKRDFLGITPFIWAAV
CGKEEVAKLLLERETIIPDKPDKLFRRTAFTWASWKGHEGIVKLLLSRAS
AKPDGTDGWWGKTPQVMNMVLGKKYVDPNRPDKYGQTAILLAAEEGHEGV
VKLLLGRKDVKPDAADGFGRTPLLCASSEGREGVVKLLLERRDINISKPN
TNGETPLLSAARGGYEGVVGQLLGRKDVIPDDGRTPLSFACKNGRDALVK
LLLGRRDVNPNRSDKDGKTPLLWAAKNGHAELVKRLLEKQAIIPDKPDKY
FRRTALSCAAGKGHEGVVKLLLGTRYVDPNRPDKYGQTAILLAAEEGHSG
VVRQLLERKDVKPDLADGYGRTPLLSASIEGREAVVKLLLERRDVNIDKY
GQTPLSLASEEGHSGVVKLLLGRMDVNPDAADGYGRTPLLWASSKGQEAV
VKLLVERQDVNIDRPDKSGEAPLLSAAGCGYEVVVGLLLGRKDAESGMLG
KYCQTLLFLAAKKGHDGIVRLLLGRDDVNPDMPDIDDTNGRTPLIGAARN
GHEGVVKILLGRDDTNPNKPDTDGRPPLCWAAGSGHAGVIALLQSPASVT
RSAE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB13YE08FM1 Ankyrin repeat protein [Aspergillus fumigatus A1163]2e-10


Manual Annotation:

Please find below the necessary files for GSTUMT00001852001 annotation :

link to GSTUMT00001852001 Artemis file
link to scaffold_296 sequence file
link to scaffold_296ESTs