Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001820001
Length(AA) : 1124
Localization : scaffold_120
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_03511
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001244070.1| Score: 1835 E_value: 0.0
KEGG Definition: ubiquitin conjugating enzyme, putative [EC:6.3.2.19]; K10582 ubiquitin-conjugating enzyme E2 Q
Accession: afm:AFUA_4G13940 Score: 1557 E_value: 1e-171
KOG Definition: Predicted ubiquitin-conjugating enzyme
Classification: [Posttranslational modification
Kog Number: KOG0897 Score: 168 E_value: 4e-12
PFAM Definition: UQ_con, Ubiquitin-conjugating enzyme. Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine..
Pfam Number: pfam00179 Score: 120 E_value: 1e-06
Swissprot: Q8WVN8|UB2Q2_HUMAN
Gene Ontology:
GO:0004842 = Molecular function: ubiquitin-protein ligase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.022NO0.058NO0.022NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.060.0650.944_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.05453First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001820001
MADIRRGEDDGSSKFTFTSKDLSKVDITVFVPDLDEYPKAHKYLIYVTSE
DVPENFTSSLERVQDACSGHNLPHLLGRIVGALTLSPDPTDESSDDEDED
TELESDLDWEADIPDGAVRDLPGDCRSSAPKNWEEGAPTKTFTRKLKLQL
KEDLRHVCEAGFRVGVFGDFKGEVFYITISIRISKLGISDEALAAWLLDK
DKYFIVIIHYTNLYKTLEWLLQPENRSRVRREMQMWAGLSTSYKPSLYEC
IQVFTKVKDRGSAGLDGVKGGEVGGLHSFFMSNAITELLNLRLVPLIKYR
LQGDLGWEGAEALFKDIEAFPTAPPMEYQKYRDLQSEPKTALNPIVAADA
LSKQQFRGIGRSFPLIAMQYAIRHLVRCTEFCLVCHDKIQSDFEAMKPYV
CDSPLCLYQYMSLGFGPSIESEILTQPTVVDLLVSFCYRAAEALKLRTFP
TGMNILVPSESKHQARYFEPANRVVFSTPFGSPGVKVGDWIYFSPCKDRA
PCHLRVAEVYWPEVHVERPINVPQDSRNQLPSSPLADSAPPAFYNSTQGE
GFAGSVCVHTRAFDEVNIRMKCLAITRLLDLLPSVGEMRAWLKSNSLSGL
NASLRTWVDRILPSSLNILRWIIASNRSCIVPADHELGADGLPVAMRKND
SKVLGVSDCLQFRFAMGAPDKEQRFVNSVKEAGDRLNLQYPTLFAFHGSP
LANWHSIVRSGLNYESMAHGRAFGNGVYHSLDMGVSLGYSTNRTNHGWLE
SILNVQNAVCLNEIVNAPREFVSSSPHLVVDKLNWIQTRYLFVKVANIDI
QTPTSPLSDNVEYLQQDIRFSPRGRAGIALQIPALGSKSHIQAGAPNART
KDLQTSLPNSPDRSVLDEFSMLDSATNIIDVENDDARSDTTETTDVMAYF
SDEEDENMENKNTSPHCSDTGVILFQPDTHNISSVLLLPPPTYASPAGTR
RLTADLHHLLSLQKKYPLEELGFYMNPSSVSNVYQWHIELHSFPPDIPLS
ADLAAKNLSSVLLEFRFGPNFPMSPPFVRVVRPRFLAFAEGGGGHVTAGG
ALCMELLTNSGWSAASSMESVLLQIRMAITSEVKPARLVPGVVRDYTAGE
ARDAYVRACRAHGWKVPQDFLKMI

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB55YC03FM1 No hit found
SY0AAD60YJ18FM1 predicted protein [Ajellomyces capsulatus NAm1]2e-53


Manual Annotation:

Please find below the necessary files for GSTUMT00001820001 annotation :

link to GSTUMT00001820001 Artemis file
link to scaffold_120 sequence file
link to scaffold_120ESTs