Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001773001
Length(AA) : 1607
Localization : scaffold_118
Number of EST contigs matching the gene: 3
Number of ESTs : 22
  User annotation : No user annotation

Blast Results:

Nr Definition: predicted protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001538356.1| Score: 484 E_value: 6e-46
KEGG Definition: hypothetical protein
Accession: ani:AN6228.2 Score: 476 E_value: 3e-45
KOG Definition: Thyroid hormone receptor-associated protein complex
Classification: [
Kog Number: KOG3598 Score: 173 E_value: 1e-12
PFAM Definition: GYF, GYF domain. The GYF domain is named because of the presence of Gly-Tyr-Phe residues. The GYF domain is a proline-binding domain in CD2-binding protein..
Pfam Number: pfam02213 Score: 171 E_value: 2e-12
Swissprot: Q5U236|PERQ2_XENLA

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.132NO0.465NO0.098NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2750.0550.755_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00829First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001773001
MSTSSHFASSFSTTAGGGKDSGINTANNSGNPSAPGGGGSGGGGSGDWSR
RPNGTSNSSHRRPSLSTTLTHPPTSQHSQPPLTPSASNVYHPPHHFNRSG
AGSAVSTSYGKEDLLSIFKAQEQNGTLREVKDLLLGDLGSGSGGGWGRGG
DEAGGAEVCWDKEAGSKPVSLEDMSEEEKELFASNVNSPHKAPPNQNNQG
ATNHHNTNHTPPQNRNKITAPPGAGATGVNRPTNRRRETSDAALTNSPFS
SAPPQLPRRRTELRDEDQTREGGGRDRTLFGRWGSTSGTSGQAGDDDHGK
ERVEDGSGSGGRSSGLFRRGSTAWGPSGSTGGGGFASSALNSPMGTFGNG
VFGGAMGGFSLQSASSEKLKTSSNAGNTGQKGSTAQPKVEEEDEQAEDTQ
RPRSPNPDGLREEHERERPMSSDTDPFGLGGDGDDREHDHDQRQEQQQPQ
HSPLPTPSLEQRMKDNSFNTTSNTQNRQGNSVSTPTKVRSDLGFSGIGTT
RDGSNVGGLHQQLQNLQLNQQGHFPLHGRSREGSIGGIIGGLHEYEPLSP
TETNPYQSPAPEKADDDDMPENGGGGGIIGGFRRGDVGAPGSDRSGRSST
AGLGSGIGSGLASFSSLGGGTLWGGTSGPSGLGSNTAPSSFFGSGGMLGD
LNGPNTIGSGGSFSGGGIGGMGSIGGGGYGSASRASRLGQLFQQEPQVEE
EQQPQQLQQVGFESNDAFGDLRFGNAFGSGRNGFGSATDSPMRERPGVMD
IFNLHTTRSVGNLAAASGENTLYPRERDDPLPGIHSLHQNQPAQPAPLSA
GIQPPAVQQPPQIRPPPGTVAPQQHVMVMPDKIQWTYRDPSGTVQGPFSG
LEMHDWYKTGFFTQDLAVKRVEDPEFEQLGNLVRRIGNTREPFLVPLQAP
ANSALVQPTTSQPNTWPGVAVSSSWLNENQQPQTGGTVQPPFAGSFPSFG
TTLTADQQNALERRKQEEQYLLARQREYLVQQQVFAKAHALHHQHSQQSL
HSQPSFGSLQGSLQSPGGFATPVTTTTVGIGGQNSFEPGVLLRQAGAAAG
SADAFGVSGGHGMPGMAGQQLQQNSQFTQQQQHVQADRLQMEQRILEMQR
QQAQKAYQTQHQQVEKRQELQQAQQQAVAAVAQAQQHQSYGVHHEREDER
FPQQAQERSGAVPAQHGEEPSPTLESSAWGIVPETVKPQAQPQVTEQPKV
SIPKSTPSTKTSPRPTQAPTTSSNEWQNSEPAPLVQPFPPPVSSQSTVLN
VGSSSMARSPSNENPHPSTSASVAPWANKDNELKQPSLTLKEIQEIEAEQ
QRNKEAHEAEQRRQLMAQQVANQPPPPAPGLPSTATWATSPSATPATGSA
SAWAKPLVKANSLPSAGAKKTLSQIQREEEARKAKTAALAASTAQAAAQI
PSAPLASGKRYADLASKTSQPMVGGAWTTVGPGGKSKLGAGGPTGPLPST
PTAPAQPLRTVSSTIGIQTAKKVVPAVVPVKPAATSAEGEFHKWAMASLT
GLKDGVKANELLAEMLNFPLDASLIADTIYDCSTTMDGRRFAAEFIRRKE
AARIGVVIEAGSSNGGGASGWNEVAKGKANTQQTARDASPETNTAFKVVS
GKKKGRR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4294 predicted protein [Ajellomyces capsulatus NAm1]4e-46
Contig7291 hypothetical protein AN6228.2 [Aspergillus nidulans FGSC A4]1e-10
SY0AAC16YB17FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00001773001 annotation :

link to GSTUMT00001773001 Artemis file
link to scaffold_118 sequence file
link to scaffold_118ESTs