Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001750001
Length(AA) : 184
Localization : scaffold_118
Number of EST contigs matching the gene: 8
Number of ESTs : 14
  User annotation : Tmelgpd1  [+]

Blast Results:

Nr Definition: glyceraldehyde 3-phosphate dehydrogenase
Specie: [Galiella rufa]
Accession: gb|AAT76626.1| Score: 271 E_value: 2e-27
KEGG Definition: G3P_COLGL Glyceraldehyde 3-phosphate dehydrogenase (GAPDH)
Accession: fgr:FG06257.1 Score: 264 E_value: 2e-27
KOG Definition: Glyceraldehyde 3-phosphate dehydrogenase
Classification: [Carbohydrate transport and metabolism].
Kog Number: KOG0657 Score: 255 E_value: 4e-23
PFAM Definition: Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain. GAPDH is a tetrameric NAD-binding enzyme involved in glycolysis and glyconeogenesis. N-terminal domain is a Rossmann NAD(P) binding fold..
Pfam Number: pfam00044 Score: 339 E_value: 6e-33
Swissprot: Q6CCU7|G3P_YARLI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.060NO0.252NO0.054NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5970.0350.459M596

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.16478First60=0.01004PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001750001
MVGRIVSSYAQYSRKCSQCHLQSYLEGVVGRGYGRGACPVWSSLFDKYLT
PFYFHQYSAISPQTFYSLYTPGSQFKMAVPIGINGFGRIGRLVLRNAAER
DDVRVVAVNDPFIDPKYAVYMFKYDSAHGNFKGEVSTNDAGDLVVNGKTI
RMYSERDPANIPWGAAGRLSFRLLLPTLPCSLLV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig845 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) gb|AAB38246.1| glycerol-3-phosphate dehydrogenase [Boletus edulis]1e-33
Contig902 glyceraldehyde 3-phosphate dehydrogenase [Galiella rufa]3e-50
SY0AAA63YH04FM1 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) gb|AAB38246.1| glycerol-3-phosphate dehydrogenase [Boletus edulis]1e-31
SY0AAA8YM24FM1 glyceraldehyde 3-phosphate dehydrogenase [Galiella rufa]2e-12
SY0AAB32YG21FM1 No hit found
SY0AAB42YH01FM1 glyceraldehyde 3-phosphate dehydrogenase [Galiella rufa]6e-52
SY0AAC22YG06FM1 hypothetical protein [Yarrowia lipolytica]4e-26
SY0AAC50YP09FM1 hypothetical protein NFIA_061320 [Neosartorya fischeri NRRL 181]1e-47


Manual Annotation:

Please find below the necessary files for GSTUMT00001750001 annotation :

link to GSTUMT00001750001 Artemis file
link to scaffold_118 sequence file
link to scaffold_118ESTs