Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001743001
Length(AA) : 792
Localization : scaffold_118
Number of EST contigs matching the gene: 3
Number of ESTs : 153
  User annotation : TmeleEF3  [+]

Blast Results:

Nr Definition: elongation factor 3
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001541895.1| Score: 2527 E_value: 0.0
KEGG Definition: translation elongation factor eEF-3, putative; K03235 elongation factor EF-3
Accession: afm:AFUA_7G05660 Score: 2509 E_value: 0.0
KOG Definition: ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b
Classification: [Amino acid transport and metabolism
Kog Number: KOG0062 Score: 1111 E_value: 1e-121
PFAM Definition: ABC_tran, ABC transporter. ABC transporters for a large family of proteins responsible for translocation of a variety of compounds across biological membranes. ABC transporters are the largest family of proteins in many completely sequenced bacteria. ABC transporters are composed of two copies of this domain and two copies of a transmembrane domain pfam00664. These four domains may belong to a single polypeptide, or belong in different polypeptide chains..
Pfam Number: pfam00005 Score: 325 E_value: 2e-30
Swissprot: P25997|EF3_CANAL

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.307NO0.674NO0.246NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1430.1870.625_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01192First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001743001
MTALKCLDVLVRTAPGQTALRLPELIPTVSEAMWDTKPEIKKAARAAMEK
LCSLISNNDINRFIPELINCIAKPERVPETVHLLGATVFVENVQAPTLSI
MVPLLERGLADRDTTIKRKAAVIVDNMCKLVEDPQIVAPFLPKLMPNLQK
NYDNMADPEAREKTKQGLDTLTRVGDVKDGKIPEISTAGDPKVILETVKT
VLSNRKDLAAKFEPVLTYIACIAGSLVDERENEVLIWTEHTVPYFAAFLP
EGEAQGTAETLRKRAAPGAAEEEVDEDDEEGEDLCNCTFNLAYGAKILLN
QTHLRLKRGQRYGLCGPNGSGKSTLMRAINNEQVEGFPKKTEVKTVFVEH
DLDSADTEKTVVGWTFDKLAETGAGVSVEDIKTKLGEFGFQETMFDAPIT
SLSGGWKMKLALARAVFENPDILLLDEPTNHMDRQNVKWLEQYLINSPCT
SIIVSHDSGFLDNVVQHIIHYERFKLKRYRGNLKAFTEKVPSARSYYELG
ASEINFKFPEPGYLEGVKTKAKAIVRVSNMSFQYPGTSKPQIRDITFQCS
LGSRIAVIGPNGAGKSTLVNVLTGELIPTSGDIYTHENIRIAYIKQHAFA
HIDNHLEKTPSEYIQWRFQTGEDRETMDRANTKITDDDEQAMNKIFRIEG
TQRRVCLAASTWQRPHLIVLDEPTNYLDRDSLGALSRALKEFQGGVIIIT
HSEEFTKDLTEEVWSVLDGKMTPSGHNWVQGQGAGPRLQEKAGDEDVFDA
MGNKVEGGKKKKKLTSSELRKKKKERIARRKRGEEVFSDEDE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4470 hypothetical protein CIMG_05477 [Coccidioides immitis RS]0.0
SY0AAA47YL12FM1 hypothetical protein CIMG_05477 [Coccidioides immitis RS]5e-48
SY0AAA57YJ19FM1 hypothetical protein CIMG_05477 [Coccidioides immitis RS]6e-66


Manual Annotation:

Please find below the necessary files for GSTUMT00001743001 annotation :

link to GSTUMT00001743001 Artemis file
link to scaffold_118 sequence file
link to scaffold_118ESTs