Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001733001
Length(AA) : 204
Localization : scaffold_118
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_03632
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001595543.1| Score: 456 E_value: 6e-44
KEGG Definition: hypothetical protein
Accession: fgr:FG02455.1 Score: 419 E_value: 6e-40
KOG Definition: Uncharacterized conserved protein
Classification: [Function unknown].
Kog Number: KOG4149 Score: 276 E_value: 1e-25
PFAM Definition: No Hit Found
Swissprot: Q4IK03|MIA40_GIBZE
Gene Ontology:
GO:0005743 = Cellular component: mitochondrial inner membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.430NO0.693NO0.314NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8710.0360.107M253

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.11848First60=0.61333PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001733001
MSVLRPVGRSLLGRQILSTPVRPTVPALLLNNRSLFTPTPGQKRSSFKSF
VARWAVAGGLIYAYATSNVFADEPKFPQDELKTIPPEDQDRPKSLLPEKG
GKLGRRQRSDAEDDGLLTADEARGGPEDLEAEAGQEGAFDPETGEINWDC
PCLGGMAHGPCGEEFKTAFSCFVFSKEDPKGVDCIERFRDMQTCFQKVNC
SFMG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig5573 hypothetical protein SS1G_03632 [Sclerotinia sclerotiorum 1980]1e-42
SY0AAB60YK09FM1 hypothetical protein SNOG_05959 [Phaeosphaeria nodorum SN15]4e-33


Manual Annotation:

Please find below the necessary files for GSTUMT00001733001 annotation :

link to GSTUMT00001733001 Artemis file
link to scaffold_118 sequence file
link to scaffold_118ESTs