Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001713001
Length(AA) : 914
Localization : scaffold_116
Number of EST contigs matching the gene: 2
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: DNA excision repair protein Rad2
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001257869.1| Score: 1293 E_value: 1e-140
KEGG Definition: hypothetical protein
Accession: ang:An03g02890 Score: 1123 E_value: 1e-120
KOG Definition: 5'-3' exonuclease
Classification: [Replication
Kog Number: KOG2520 Score: 835 E_value: 1e-89
PFAM Definition: XPG_I, XPG I-region..
Pfam Number: pfam00867 Score: 318 E_value: 1e-29
Swissprot: P28706|RAD13_SCHPO
Gene Ontology:
GO:0005634 = Cellular component: nucleus
GO:0006295 = Biological process: nucleotide-excision repair
DNA incision
3'-to lesion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.028NO0.057NO0.023NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.120.0460.909_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00285First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001713001
MGLAKEQLDSMFPNRMDFSKFQIERVKERNDLTQRLMNLNGRSDQPGSYD
PTRVAGEKGREYVLVKNDGVEGGWVLGVVGSSGAREGERNKPIIVDNTEE
LEGEGEEDPDDDEEFEDVPVEGLNRLPHIESRDDREGSYTYDVLDGAEAQ
MLRRAIYESKREQNGSNNKWKLSPDPISDTSSDEELQKAIQLSLETHRGY
HNTELESTFFGRDLSDIAEEEEEDEPINNKGKEKAIEDPDFSRAISESRR
MNGGDMPRDSGWGAPGESSKGSSSSVVPKNPFGGLLPFERLDMGKSMLFK
GKNPEGEPKEMGEGGDKGEDKNGGDSVPLPPWFTGGPKKDLAEEMRLANR
DRELTREEKERQEYELEMQRIANKRYKERDVVMIDSDDGEDNDDVVMLDG
LSEKGDLNMDDVADRLRTHPPGPISSQREGDEEEIEWEESDHESAPATVE
SAAAPKPYPRESPPPPDPDGAENGVPREATPPLEYTDDEEQYAEPEDLEL
AQQLVAESEEHARFAAELNNKPQQQTREGYERELHTLRVQQAKDRRDADE
VTQAMVQECQQLLTLFGIPYITAPMEAEAQCAELVRLGLVDGIVTDDSDT
FLFGGTRVYKNMFNQAKFVECYLAGDLEKEYALDRTGLIRIAHLLGSDYT
EGVPTVGPVTAMELLAEFASDNGLTEFKEWWTAVQTGLRKPADDDDNPFR
KKFRKNATKVFLPTNFPDPRVDEAYMHPEVDHDPSQFEWGMPDLDGLRRF
LMATVGWSQERTDEVLVPVIKDMNTKQVEGAQSTITQFFEGRMGTGAAGM
AGAPRRKVKKSKRMEKAMLSLHERAKRINGSGGGTAGEQDGDLEDWDEGE
AEVAEKPAKRKRALARRSRGKKSLVNNDSGEGRDDEELGGEGYREEQVPA
PVKKRKTTTGRGGK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1128 No hit found
Contig1859 hypothetical protein CIMG_08043 [Coccidioides immitis RS]7e-80


Manual Annotation:

Please find below the necessary files for GSTUMT00001713001 annotation :

link to GSTUMT00001713001 Artemis file
link to scaffold_116 sequence file
link to scaffold_116ESTs