Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001690001
Length(AA) : 927
Localization : scaffold_116
Number of EST contigs matching the gene: 3
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001539598.1| Score: 1058 E_value: 1e-113
KEGG Definition: predicted protein
Accession: aor:AO090120000164 Score: 789 E_value: 7e-82
KOG Definition: Predicted lipase/calmodulin-binding heat-shock protein
Classification: [Lipid transport and metabolism
Kog Number: KOG2088 Score: 159 E_value: 3e-11
PFAM Definition: Lipase_3, Lipase (class 3)..
Pfam Number: pfam01764 Score: 192 E_value: 5e-15
Swissprot: Q8NCG7|DGLB_HUMAN
Gene Ontology:
GO:0005886 = Cellular component: plasma membrane

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.393NO0.555NO0.308NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5640.3250.069M435

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.0795First60=0.15429PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001690001
MSTPHPASGPTLLPAPVASLVSLISRSTTASIRLGSIIGGTILDSARLGT
LTGLEIGRAAAEGILARAGRDVRDDGWADRSINFVRSSISLTQLLLSTGF
EIGLTTLTTVSGLAETYVLTLDSIFGSTESSRAISAIVALIKKEIEENEA
GEGKVGVSDLVIGLSCFAILQMKTKKRRELEIKMDLEWDEVVEDITDVAR
RGENTAVAVYGQASGDETGGSPPALMFQSFPESADISVTTSSTTTNTTTI
EVIGSNPPDFAPPPGAVVLSESSQHDASRPHYRIVYETTTKKSSNRRMKR
EEGAFVEIPSEERGRILGEIDAPPPPPPKEKGKRERVTKRSDESQPHGRS
GSAGFLDVPIEANQRKRITALSNSSGDPKRNKERSKDKEGRRSSKRPVAP
QGKEKKKKNFVSQSLLPLGKSKESSSEDGGLLLGADSPELRFIESHARTS
SRGGIFRRESSVSKSSGTSSAQQRDSLLGRASTSPHLGQADNHMSPGHSR
NGSYTPSIYTIHTSHSQTSLTLESSTPLVFPSGHLIENLSKYMRFASASY
GQKFLRLFGIGDAPAAFPATASHHAEHHSFSYHTSLPVDTILLSSFTDPG
GGYDIDGEVNTGIPLVHFVAVDHGAQAIVVTCRGTLGLEDVLTDLTCEYA
DLWLRGTKYRAHKGMLNSALLLIKKDSRLLNTIKSSLEKFPGYGLVLCGH
SLGGGVAAILAILLSAPSGSSPGPYTTTNAYIQLLHSSSLRIPEGRQIHC
YAYGPPACISEPLRRRTCSLITSVVNGNDCIPTLSFGIIRDFWTVAVAFK
TDTQGTKAEIRSRILQGLTSGNVSSIMGDGDDWAWSVVKTCRAGMLSEKL
APPGKVYKVQGERVFIKDEGGGGNGGMKSKWRVKGWRVRDVERWFGEVGF
GGGMFGDHNPGEYERVLELLARGLCDD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig357 hypothetical protein AN8743.2 [Aspergillus nidulans FGSC A4]6e-33
Contig1790 hypothetical protein SS1G_14125 [Sclerotinia sclerotiorum 1980]2e-45
SY0AAA22YA10RM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00001690001 annotation :

link to GSTUMT00001690001 Artemis file
link to scaffold_116 sequence file
link to scaffold_116ESTs