Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001686001
Length(AA) : 309
Localization : scaffold_116
Number of EST contigs matching the gene: 3
Number of ESTs : 26
  User annotation : No user annotation

Blast Results:

Nr Definition: predicted protein
Specie: [Coprinopsis cinerea okayama7#130]
Accession: gb|EAU82184.1| Score: 145 E_value: 2e-07
KEGG Definition: unknown protein
Accession: ath:AT2G40935 Score: 126 E_value: 1e-05
KOG Definition: No Hit Found
PFAM Definition: PLAC8, PLAC8 family. This family includes the Placenta-specific gene 8 protein..
Pfam Number: pfam04749 Score: 198 E_value: 3e-16
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.037NO0.110NO0.049NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1410.1040.828_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=52.4092First60=0.00556PredHel=2
Topology=(241-263,276-298)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001686001
MSVNKNPTDTKVAAVASDPPSYTDATSSTVPVYGDGNVFTDQPTMSYTAT
SPEPYTPRKKGWMTGIFDCFVEPASSAKALCCPCVSYAQTRHRLHAPNTP
APVLSTPCLGYCLVMSCFPGAEFIFGFMQRGDIRNRLHIDHSLPKGTVSP
ASTSGEPGRTRVFESMDSAGGCVDDFWRHFFCAPCSLAQEDREVSRWERE
VAGGEGWCDEDEELGGFRGVETTRGEEGISEEGERLLGCERVPFPFVYSS
FSLSLLGITIGQGGSVGRLVGWFGRMGCRASAFSTRIISLLLFLSRCFFF
FFLRSHSFY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig7173 No hit found
Contig7244 predicted protein [Coprinopsis cinerea okayama7#130]2e-07
SY0AAB41YC15FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00001686001 annotation :

link to GSTUMT00001686001 Artemis file
link to scaffold_116 sequence file
link to scaffold_116ESTs