Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001651001
Length(AA) : 551
Localization : scaffold_119
Number of EST contigs matching the gene: 3
Number of ESTs : 35
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_00860
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001598771.1| Score: 1581 E_value: 1e-173
KEGG Definition: hypothetical protein
Accession: ncr:NCU05850.1 Score: 1535 E_value: 1e-168
KOG Definition: Monodehydroascorbate/ferredoxin reductase
Classification: [General function prediction only].
Kog Number: KOG1336 Score: 888 E_value: 6e-96
PFAM Definition: Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain..
Pfam Number: pfam07992 Score: 490 E_value: 7e-50
Swissprot: Q10499|YDGE_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.041NO0.054NO0.029NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0830.0640.911_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.24589First60=0.00049PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001651001
MATVQEYKLKLDNVDLRNREKVEAEVEGVEGGKVILLKVNDQLRALGAKC
THYGAPLVKGVIAGDGRITCPWHGACFNTDSGDIENAPALDHLAAFPVSI
KNGAAYIIGDEATIRAGKRKPDVSYKPVITAASEHVVIVGGGSGAMGAIE
VLREKGFKGQITVLTKERYLPIDRTKLSKALIPDEQKLQWRDAQHFRDAG
VDFHLSTEVSSIDFKAHKIHTKTGGEFSYSKVLLCTGGTPKRLPMRGFKD
LRDIFVLRDVDDVQGINSAIGDNGKKVVVVGSSFIGMEVSNCLAQKGNDI
TIVGMEGAPLERVMGAMVGKIFQNQLEKSGVKFRMNSGVEFAEPSSADPS
KVGSVLLKSGEKLEADLVILGVGVVPATDYLKQSSIKLEDDASVKVDRYF
RVEGVEDAYAVGDIATYPYNGPGSDENTKVRIEHWNVAQNAGRQAALHIT
TNSEPTHFIPVFWSALGSQLRYCGATPKGYDDIVLRGNPDEAKFIAYYTK
GQDVVAVATMQKDPYMTQCAELMRRKMMPTKDEIVGGVDVLNVEVPAGVQ
I

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1412 hypothetical protein BC1G_09030 [Botryotinia fuckeliana B05.10]2e-51
Contig6869 hypothetical protein SS1G_00860 [Sclerotinia sclerotiorum 1980]1e-168
SY0AAC55YK04FM3 hypothetical protein FG02433.1 [Gibberella zeae PH-1]3e-33


Manual Annotation:

Please find below the necessary files for GSTUMT00001651001 annotation :

link to GSTUMT00001651001 Artemis file
link to scaffold_119 sequence file
link to scaffold_119ESTs