Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001645001
Length(AA) : 346
Localization : scaffold_119
Number of EST contigs matching the gene: 12
Number of ESTs : 540
  User annotation : TmelADH6  [+]

Blast Results:

Nr Definition: hypothetical protein SS1G_09135
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001590370.1| Score: 1038 E_value: 1e-111
KEGG Definition: hypothetical protein
Accession: fgr:FG01686.1 Score: 981 E_value: 1e-104
KOG Definition: Alcohol dehydrogenase
Classification: [
Kog Number: KOG0023 Score: 922 E_value: 1e-100
PFAM Definition: ADH_zinc_N, Zinc-binding dehydrogenase..
Pfam Number: pfam00107 Score: 283 E_value: 4e-26
Swissprot: Q04894|ADH6_YEAST
Gene Ontology:
GO:0005625 = Cellular component: soluble fraction
GO:0008106 = Molecular function: alcohol dehydrogenase (NADP+) activity
GO:0033833 = Molecular function: hydroxymethylfurfural reductase (NADH) activity
GO:0033845 = Molecular function: hydroxymethylfurfural reductase (NADPH) activity
GO:0006066 = Biological process: alcohol metabolic process
GO:0033859 = Biological process: furaldehyde metabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.242NO0.262NO0.142NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.070.090.922_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=3.54009First60=0.00663PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001645001
MSTEYSFKGWVGSSNDCIEKQNLVYKDIEPKRFTEDDVDIRITHCGICGT
DVHTLTNGWGFTSYPVVVGHEIVGTAVKVGKNVQGIKVGDRVGCNADNES
YCKDMVGTYNGKYPDGSMSTGGFADYTRVPGHFVFKIPEALSSEIAAPML
CGGITMFSPLKRNGCGPGKTVAIIGFGGLGHFGVLFAKALGADKVIAISR
KPNKAADALAMGADDYVATDDNPNWASKHANTIDLIVSTVNSPKLPIDSY
LQLLRHRGAFIQVGAPEDSVPGFNILPLIMKAVHVTGSLIGSPKEIEEML
ELAARKGIKSWVNPWPLEKVNDALQAFERGEPRYRIVLVNEKHAQK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig513 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]1e-57
Contig656 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]1e-65
Contig1549 hypothetical protein FG01686.1 [Gibberella zeae PH-1]2e-77
Contig1858 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]5e-60
Contig2168 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]1e-64
Contig3056 hypothetical protein SS1G_09135 [Sclerotinia sclerotiorum 1980]1e-117
Contig3288 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]2e-65
Contig7338 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]6e-59
SY0AAA14YC24FM1 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]6e-41
SY0AAA15YO03FM1 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]3e-48
SY0AAB36YB13FM1 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]2e-58
SY0AAB49YA20FM1 hypothetical protein BC1G_09005 [Botryotinia fuckeliana B05.10]9e-43


Manual Annotation:

Please find below the necessary files for GSTUMT00001645001 annotation :

link to GSTUMT00001645001 Artemis file
link to scaffold_119 sequence file
link to scaffold_119ESTs